SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_021002739.1.5422 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_021002739.1.5422
Domain Number 1 Region: 42-408
Classification Level Classification E-value
Superfamily L domain-like 9.52e-46
Family Ngr ectodomain-like 0.0024
Further Details:      
 
Domain Number 2 Region: 445-654
Classification Level Classification E-value
Superfamily L domain-like 9.35e-21
Family Ngr ectodomain-like 0.0044
Further Details:      
 
Domain Number 3 Region: 691-804
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.16e-17
Family Toll/Interleukin receptor TIR domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_021002739.1.5422
Sequence length 829
Comment slit homolog 3 protein-like [Parasteatoda tepidariorum]; AA=GCF_000365465.2; RF=representative genome; TAX=114398; STAX=114398; NAME=Parasteatoda tepidariorum; strain=Goettingen; AL=Scaffold; RT=Major
Sequence
MNATLVALILMFSICLVVGTKNNMCKVQYVKENPRVICENVVSLRAIRSYLVLNLKSKPV
AQLLFYCIMTKKLSLSRKTFFDLKISEISMSCPFESIRDNAFTRTRSLTKLHLYQTEFCR
IPNAISRIKSLTTLEIVDGRLTEITTELQYMLELANLSLARNRISSLLGSAFLGDVKLQS
IILTSNKLSRLDNKTFDPCPSLRLIRLDKNNLITVDGLFQNPSLMNIDLGYNLLKTIPED
LFYNLENVTSVNLRRNYIRNVTKWFSGSNRLEHIDLSINLIESCDYAFQSMQSLKTINLH
DNRLSKITKNCFSSIPSVVELILSQNFISQIDSKALSQLDRLQSFDVSLNGLKILSRESF
PEVLKIQELFAYGNYWVCDCRLLWIRDWMENTTLNTSNFDFSCSLPIRFKSKQLSQLSKE
DLSWPKEDCPSYCDCSCVAYRDEGYANVNCASKRLTQIPTGFPELTIELNLQENLLSNPV
EINLPSTSKLRILNLERNFISRLDFNLPNNIEVLLLAENNITRFFNIPPSNVKTFTLSRN
PFPELTVELNLQENLLSNPIEINLPSTSKLRILNLERNFISRLDFSLSNNIEVLFLAENN
ITRFFNNPPSNVKTFTLSRNPWRCDCNTLPFRKWIVAQNAMILDVNETRCSFEEDRESLR
GRVIITLSEIELCPKLIRNYNLMVAEVSVLELKHPFYKLFVPQRDIKTGNFEIDNLMRRM
LDCKRTVFLLTKNYLENEFCMEIFRVAFANSLEEKLHRIILVKYGPLPPLKEMDQSLKTV
MVSSRCLKFGDKLFWDMLRYEMSEKRPDTSIDYELQDDNSDDVPLVQEF
Download sequence
Identical sequences XP_021002739.1.5422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]