SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_021044449.1.100879 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_021044449.1.100879
Domain Number 1 Region: 52-548
Classification Level Classification E-value
Superfamily Sema domain 2.62e-98
Family Sema domain 0.0022
Further Details:      
 
Domain Number 2 Region: 1410-1535,1701-1858
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4e-33
Family p120GAP domain-like 0.023
Further Details:      
 
Domain Number 3 Region: 889-980
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000827
Family Other IPT/TIG domains 0.014
Further Details:      
 
Domain Number 4 Region: 980-1070
Classification Level Classification E-value
Superfamily E set domains 0.000000000000108
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.056
Further Details:      
 
Domain Number 5 Region: 1067-1148
Classification Level Classification E-value
Superfamily E set domains 0.0000000000191
Family E-set domains of sugar-utilizing enzymes 0.074
Further Details:      
 
Domain Number 6 Region: 551-603
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000379
Family Plexin repeat 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_021044449.1.100879
Sequence length 1925
Comment plexin-D1 [Mus pahari]; AA=GCF_900095145.1; RF=representative genome; TAX=10093; STAX=10093; NAME=Mus pahari; AL=Chromosome; RT=Major
Sequence
MARRAAGGAPPSARDAAAVPLRPRPHSRGPVLLPLPLLLLLGAARAGALEIQRRFPSPTP
TNNFALDGTAGTVYLAAVNRLYQLSSANLSLEAEATVGPVPDSPLCHAPQLPQASCEHPR
RLTDNYNKILQLDPGQGLVVACGSIYQGLCQLRRRGNISALAVSFPPVAPTAEPVTVFPS
MLNVAANHPNASTVGLVLPPTSGTGGSRLLVGATYTGFGSAFFPRNRSLEDHRFENTPEI
AIRSLDARGDLAKLFTFDLNPSDDNILKIKQGAKEQHKLGFVRAFLHPAVPPHSAQPYAY
LALNSEARAGDKDSQARSLLARICLPRGAGGDAKKLTESYIQLGLQCAGGAGRGDLYSRL
VSVFPAREQFFAVFERPQGVPGARNAPAALCAFRFADVQAAIRAARTACFVEPAPEVVAV
LDSVVQGTGPACESKRNIQLQPEQLDCGAAHLQHPLTILQPLRASPVFRAPGLTAVAVAS
ANNYTAVFLGTATGRLLKISLNESMQVVSRRVLTVAYGEPVHHVMQFDPLDPGYLYLMTS
HQMARVKVAACEVHSTCGDCVGAADAYCGWCTLETRCTLQQDCTNSSQPHFWTSASEGPS
RCPAMTVLPSEIDVHRDYTGMILQISGSLPSLSGMEMACDYGNGVRAVARVPGPAYDHQI
AYCSLLPRAQFPSFPAGQDHVTVEMSVRVKGHNIVSANFTIYDCSRIGQVYPHTACTSCL
STQWPCSWCTQLHSCVSNQSQCQDSPNPTSPQDCPQILPSPLAPVPTGGSQDILVPLTKA
TFFHGTSLECSFGLEESFEAVWVNDSLVRCNQVVLHTTQKSQVFPLSLKLKGPPDRFLDS
PNPMTVVVYNCAMGSPDCSQCLGREDLGHLCVWNDGCRLRGPLQPLPGTCPAPEIRAIEP
LSGPLDGGTLLTIRGRNLGRRLSDVAHGVWIGSVACEPLADRYTVSEEIVCATGPAPGAF
SDVVTVNVSKEGRSREQFSYVLPTVHSLEPPMGPKAGGTRITIHGSDLNVGSMLQVLVND
TDPCTDLTRTATSITCTVPGGTLPSPVPVCVRFESRGCVHGNLTFWYMQNPIITAISPGR
SPVSGGRTITVAGERFHMVQNVSMAVHHIGREPTFCKVLNSTLITCPSPGALSNASAPVD
FFINGRAYADEAAEEMLDPAEAQRGSRFRLDYLPNPQFSTAKREKWIKHHPGEPLTLVIH
KEQDSLGLESHEYHIKIGQVSCDIQIISDRVIHCSVNESLGTAEGQLPITIQVGNFNQTI
ATLQLGGSETAIVVSIVICSVLLLLSVVALFVFCTKSRRAERYWQKTLLQMEEMESQIRE
EIRKGFAELQTDMTDLTKELNRSQGIPFLEYKHFVTRTFFPKCSSLYEERYVLPSKTLNS
QGGSPPQETHPLLGEWNIPEHCRPSMEEGISLFSSLLNNKHFLIVFVHALEQQKDFAVRD
RCSLASLLTIALHGKLEYYTSIMKELLVDLIDASAAKNPKLMLRRTESVVEKMLTNWMSI
CMYGCLRETVGEPFFLLLCAIKQQINKGSIDAITGKARYTLNEEWLLRENIEAKPRNLNV
SFQGCGMDSLSVRAMDTDTLTQVKEKILEAFCKNVPYSQWPRAEDVDLEWFASSTQSYVL
RDLDDTSVVEDGRKKLNTLAHYKIPEGASLAMSLTDKKDSSLGRVKDLDTEKYFHLVLPT
DELVEPKKSHRQSHRKKVLPEIYLTRLLSTKGTLQKFLDDLFKAILSIREDKPPLAVKYF
FDFLEEQAEKRGISDPDTLHIWKTNSLPLRFWVNILKNPQFVFDIEKTDHIDACLSVIAQ
AFIDACSISDLQLGKDSPTNKLLYAKEIPEYRKIVQRYYKQIQDMTPLSEQEMNAHLAEE
SRKYQDEFNTNVAMAEIYKYAKRYRPQIMAALEANPTARRTQLQHKFEQVVALMENNIYE
CYSEA
Download sequence
Identical sequences XP_021044449.1.100879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]