SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_021053616.1.100879 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_021053616.1.100879
Domain Number 1 Region: 28-184
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.64e-30
Family Calponin-homology domain, CH-domain 0.0033
Further Details:      
 
Domain Number 2 Region: 202-281
Classification Level Classification E-value
Superfamily GAS2 domain-like 4.97e-30
Family GAS2 domain 0.00000398
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_021053616.1.100879
Sequence length 314
Comment growth arrest-specific protein 2 isoform X1 [Mus pahari]; AA=GCF_900095145.1; RF=representative genome; TAX=10093; STAX=10093; NAME=Mus pahari; AL=Chromosome; RT=Major
Sequence
MMCTALSPKVRSGPGLSDMHQYSQWLASRHEANLLPMKEDLALWLTNLLGKEITAETFME
KLDNGALLCQLAATVQEKFKESMDANKPAKTLPLKKIPCKASAPSGSFFARDNTANFLSW
CRDLGVDETCLFESEGLVLHKQPREVCLCLLELGRIAARYGVEPPGLIKLEKEIEQEETL
SAPSPSPSPSSKSSGKKSTGNLLDDAVKRISEDPPCKCPTKFCVERLSQGRYRVGEKILF
IRMLHNKHVMVRVGGGWETFAGYLLKHDPCRMLQISRVDGKTSPVQSKSPTLKDMNPDNY
LVVSATYKAKKEIK
Download sequence
Identical sequences P11862
354785 10090.ENSMUSP00000103217 ENSMUSP00000053514 NP_032113.1.92730 XP_006540687.1.92730 XP_006540688.1.92730 XP_006540689.1.92730 XP_006540690.1.92730 XP_021053608.1.100879 XP_021053616.1.100879 ENSMUSP00000103217 ENSMUSP00000053514 ENSMUSP00000103217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]