SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_021071962.1.100879 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_021071962.1.100879
Domain Number 1 Region: 259-311
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000777
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 2 Region: 892-944
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000482
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 3 Region: 728-774
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000367
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 4 Region: 394-444
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000142
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 5 Region: 949-998
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000147
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 6 Region: 859-900
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000259
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 7 Region: 766-824
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000551
Family Classic zinc finger, C2H2 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_021071962.1.100879
Sequence length 1227
Comment zinc finger protein ZFAT isoform X3 [Mus pahari]; AA=GCF_900095145.1; RF=representative genome; TAX=10093; STAX=10093; NAME=Mus pahari; AL=Chromosome; RT=Major
Sequence
MPQIRHNLSGSFPKKIQIKSEVSSGCPTFSLSPGGSQEEPEAFFFLRRGGVAMETRAAEN
TAIFMCKCCNLFSPNQSELVTHVSEKHGEEGVNVDDVIIPLRPLNTPENPNPSKGGDEFL
VMKRKRGRPKGSTKKPSTEEEVVENHVSPSEDGPLAPEEGSRLAPSSLECSKCCRKFSNP
RQLRKHICIIVLNLGEEDGDAGATKIIPVEAGPPETGAPPPETTAADLVPRRGYQEYAIQ
QTPYEQPMKSSRLGPTQLKIFTCEYCNKVFKFKHSLQAHLRIHTNEKPYKCSQCSYASAI
KANLNVHLRKHTGEKFSCDYCSFTCLSKGHLKVHIERVHKKIKQHCRFCKKKYSDVKNLI
KHIRDMHDPQDKKVKEALDELRLMTREGKRQLLYDCHICERKFKNELDRDRHMLVHGDKW
PFACELCGHGATKYQALELHVRKHPFVYVCAICLKKFVSSIRLRSHIREVHGAAQETLVF
TSSINQSFCLLEPGGDIQQEALGDQLQLAAEEFVCPEIDGRKEEVCPGEAQPEVGLRELV
APGDAHAPPPVPLATPQGESGSLSPCKLETTVVSSDLNSLGVVSDDFLLKSDTSSAEPHA
AAEATSDTQHRDSAQTQGEEVTLLLAKAKSAGPDPESPLGGGQKVGVLPASESDSSTCLR
ANPAEASDLLPTVADGGDLGVCQPDSSTPSSDNHPGSTAFMKVLDSLQKKQMNTSLCERI
RKVYGDLECEYCGKLFWYQVHFDMHVRTHTREHLYYCSQCHYSSITKNCLKRHVIQKHSN
ILLKCPTDGCDYSTPDKYKLQAHLKVHTELDKRSYSCPVCEKSFSEDRLIKSHIKTNHPE
VSMNTISEVLGRRVQLKGLIGKRAMKCPYCDFYFMKNGSDLQRHIWAHEGVKPFKCSLCE
YATRSKSNLKAHMNRHSTEKTHLCDMCGKKFKSKGTLKSHKLLHTSDGKQFKCTVCDYTA
AQKPQLLRHMEQHASFKPFRCAHCHYSCNISGSLKRHYNRKHPNEEYANVGSGELAAEAL
IQQGGLKCPVCSFVYGTKWEFNRHLKNKHGLKVVEIDGDPKWEPAAETPEEPSTQYLYIT
ESEDVQGTQAAVAALQDLRYTSESGERLDPTAVNILQQIIELGSETHDAAAVASVVAMAP
GTVTVVKQVTDEEPSSNHTVMIQETLQQASVELAEQHHLVVSSDDVEGIETVTVYTQGGE
ASEFIVYVQEAVQPMEEQVGEQPAPEL
Download sequence
Identical sequences XP_021071962.1.100879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]