SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_021078201.1.100879 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_021078201.1.100879
Domain Number 1 Region: 131-456
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 1.31e-59
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.000000158
Further Details:      
 
Domain Number 2 Region: 462-595
Classification Level Classification E-value
Superfamily Ricin B-like lectins 6.81e-22
Family Ricin B-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_021078201.1.100879
Sequence length 598
Comment putative polypeptide N-acetylgalactosaminyltransferase-like protein 3 isoform X1 [Mus pahari]; AA=GCF_900095145.1; RF=representative genome; TAX=10093; STAX=10093; NAME=Mus pahari; AL=Chromosome; RT=Major
Sequence
MASLRRVKVLLVLNLIAVAGFVIFLAKCRPIAVRSGDAFHEIRPRAEVANLSAHSASPIQ
DAVLKRLSLLEDIVYRQLNGLSKSLGLIEGYGGRGKGGLPATLSPSEEEKAKGPHEKYGY
NSYLSEKISLDRSIPDYRPTKCKELKYSKELPQISIIFIFVNEALSVILRSVHSAVNHTP
THLLKEIILVDDNSDEEELKAPLEEYVHKRYPGLVKVVRNQKREGLIRARIEGWKAATGQ
VTGFFDAHVEFTAGWAEPVLSRIQENRKRVILPSIDNIKQDNFEVQRYENSAHGYSWELW
CMYISPPKDWWDAGDPSLPIRTPAMIGCSFVVNRKFFGEIGLLDPGMDVYGGENIELGIK
VWLCGGSMEVLPCSRVAHIERKKKPYNSNIGFYTKRNALRVAEVWMDDYKSHVYIAWNLP
LENPGIDIGDVSERKALRKSLKCKNFQWYLDHVYPEMRRYNNTIAYGELRNNKAKDVCLD
QGPLENHTAILYPCHGWGPQLARYTKEGFLHLGALGTTTLLPDTRCLVDNSKSRLPQLLD
CDKVKSSLYKRWNFIQNGAIMNKGTGRCLEVENRGLAGIDLILRSCTGQRWAIKNPIK
Download sequence
Identical sequences Q59J92 Q7TT15
NP_660253.2.92730 XP_021078201.1.100879 ENSMUSP00000083187 ENSMUSP00000083187 ENSMUSP00000083187 10090.ENSMUSP00000083187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]