SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_021264896.1.32913 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_021264896.1.32913
Domain Number 1 Region: 45-543
Classification Level Classification E-value
Superfamily Sema domain 1.57e-99
Family Sema domain 0.00085
Further Details:      
 
Domain Number 2 Region: 1414-1539,1705-1862
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.49e-36
Family p120GAP domain-like 0.021
Further Details:      
 
Domain Number 3 Region: 887-967
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000191
Family Other IPT/TIG domains 0.019
Further Details:      
 
Domain Number 4 Region: 977-1067
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000446
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.059
Further Details:      
 
Domain Number 5 Region: 546-598
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000102
Family Plexin repeat 0.002
Further Details:      
 
Domain Number 6 Region: 1066-1150
Classification Level Classification E-value
Superfamily E set domains 0.000000000726
Family E-set domains of sugar-utilizing enzymes 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_021264896.1.32913
Sequence length 1929
Comment plexin-D1 [Numida meleagris]; AA=GCF_002078875.1; RF=representative genome; TAX=8996; STAX=8996; NAME=Numida meleagris; breed=g44 Domestic line; AL=Chromosome; RT=Major
Sequence
MGTGTGMEPAASAEPRPLALLPLLLPPPLLLLLLLPGRAAGLEVQRKFLSPTPTNNFALD
GPGSRVYLAAVNRLFQLSGGELALQAEAAVGPVLDSPLCHAPQLPQASCEHPKVLTNNYN
KILQPDPEQGVLVVCGSIYQGLCQLRSMANISAVAVRFPPGGSDPLAVFPSMLNVAANHP
NASTVGLLLRRGGGEGARLLVAATYTGFGSPFFPRNSSLEDHRFENTPEIAIRALNARGD
LAKLFTFDINPSDDNIFKIKQVAKARHKLSFVRAFLQRAARRPYAYLALNSEANAVDKES
PSHSLLARICLGDAAEATLNGSGEPKKLTESYIQLGLRCGGAADAFTRLVSVFPARAAWG
GPAEEELLFGVFERAGAGGGRPHSALCVFRFAEIEETIRAARNSCFVSPAAGMVTVLDSV
VQGTGPACEKRNIQLQPEQLDCGAAHLQHPLAIVNPVTATPVFTYNGLTAVAVASVNNYT
VVFLGTASGGLLKINLDGAMRVVSRRSISVAYGEPVHPVMQFDPSDPTYLYLMTSYQMTR
VKVAACEQYSTCAECLAAADAYCGWCTMETRCSLQHECMNFTEANFWASASEGVQQCPSM
TILEPEINIDKENPVLIIQINGTIPNLNGTNISCDYGNNTHTVARVAGDYANQFIYCSLL
PREKYPAFPAGQDHVTVETALRVNGKNIIQANFTIYDCERTGDIYPKRACTSCLSTKWKC
YWCPSRYMCVSNGSWCEDALQMRKKIDCPQIVPALMDPMPTGMPQDITITLANTMFSEET
ALECHFETERTFEARWVNSSAVECVHVLLHTSEKSHLFPINLQLKDRPKRFIDNPEKMTV
EVYNCATGSTDCSQCLGREDLGHRCIWSESSSSCRLSTESPLASDVCPAPEIKKIEPLRG
PMEGGTLLTIRGRNLGRRFNDIRGAVRIGSVPCVPLPDRYVVSETIVCQTGAAQETFADV
VTVNISREGKSRERYSYMLPVVRSIAPQNGPKAGGTRVTIRGSWLDVGSELRVLVNSSKQ
CTDLSRNDSTITCTMPSAELTTAVRVCVQFENRSCAGYNIMFKYEKNPVVTDINPKKSQI
SGGRIITLEGRGFELVQNVSMVVRAIGREQTTCKVHTDTVITCPSPAASNVTAGSKPAPV
DFYLNGRLYTDDRPALDDEMYPEEALHISKFSLEYYADPQFFTAKKEKWIKHHPGEPLTL
VIHKEPDNLGLESSEYQVKIGLFSCEIQIVSDKVIHCSVNESLSTSERQLPVTIQVGKFN
YTIAMLHLGGGETAIIVSIVICSILLVLSVVALFVFCTKSRRAERYWQKTLLQMEEMESQ
IREEIRKGFAELQTDMTDLTKELNRSQGIPFLEYKHFVTRTFFPKCSSLYEECYVLPSQQ
LSSQVGSQVQETHPLLVGEWKIPESCRPNMEEGISLFSTLLNNKHFLIVFVHALEQQKDF
AVRDRCNLASLLTIALHGKLEYYTSIMKDLLVDLIDASASKNPKLMLRRTESVVEKMLTN
WMSICMYSYLRETVGEPFFLLICAIKQQINKGSIDAITGKARYTLNEEWLLRENIEAKPR
NLNVSFQGCGMDSLSVRAMDTDTLSQVKEKILEAFCKNVPYSQWPRVEDVDLEWFATSTD
SYILRDLDDTSVVEDGRKKLNTLAHYKIPEGASLAMSLSDKKDGTLSRVKDLDTEKYFHL
VLPTDESVEHKKSHRQSHRKKVLPEIYLTRLLSTKGTLQKFLDDLFKAILSIRDDKPPVA
VKYFFDFLEEQAEKRGITDPDTMHIWKTNSLPLRFWVNILKNPQFVFDIDKTDHIDACLS
VIAQAFIDACSLSDLQLGKDSPTNKLLYAKEIPEYRKIVQRYYKQIHDMPPLSEQEMNAH
LAEESRKYRNEFNTNVAMAEIYKYAKRYRSQIVAALDSNPTTKRTQLQHKFEQVIALMED
NIYECCSEA
Download sequence
Identical sequences XP_021264896.1.32913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]