SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_021304362.1.57931 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_021304362.1.57931
Domain Number 1 Region: 513-798
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.88e-76
Family Protein kinases, catalytic subunit 0.00018
Further Details:      
 
Domain Number 2 Region: 120-250
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 6.28e-26
Family alpha-D-mannose-specific plant lectins 0.0028
Further Details:      
 
Domain Number 3 Region: 141-330,358-410
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00000922
Family Quinoprotein alcohol dehydrogenase-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_021304362.1.57931
Sequence length 840
Comment G-type lectin S-receptor-like serine/threonine-protein kinase SD2-5 [Sorghum bicolor]; AA=GCF_000003195.3; RF=representative genome; TAX=4558; STAX=4558; NAME=Sorghum bicolor; cultivar=BTx623; AL=Chromosome; RT=Major
Sequence
MCHSKLLLLLFSLLITICSKLANPAMTKSFLANAELGTIWKNNPSVLHNGFPDDNFSVRL
ILPSPYGTARISVGSSVDSVPLFACGFFCAGLAATCDAYIFSIFIVNAFSIGDVLYLESP
QVVWSANHDRPVKENATVQLTELGDLVLYDADGTLVWSTNTTGKSVVGMNLTGSGNLVLL
DHRNMEVWRSFDHPTNTLVTGQVLHLGQKLIASTSATNWAKGKFYLTVLSNGMYAFAGVD
TPLAYYRSPTGGNIIANTSAYIALKNGSLEVFTSFRGTEGPDYLIQFPMNAYGLEFVRLD
WDGHLRLYQGGNGSWVSSDLLDIADPCSYPLACGEYGVCSNGQCSCPDAGLRQSGLFKLI
NPREINRGCVLTDSLSCGSAHKTRFLAVANTTRFKIIYNWTTNEEHCKVSCLNDCSCKVA
FFLHSNSSSGFCFLASDIFSMISISAQSYSRNFSSYAFIKVQEHKPMLSKGKIAIVVVCS
STFVASVIVSMLIVIRRRSAKLLQDRDIIDQLPGLPKRFCFESLKSATGDFSRRIGVGGS
GSVFEGHIGDKKVAVKRLDGINQGEMEFLMEVQTIGSINHIHLVNLVGFCAEKSHRLLVY
EYMPNGSLDKWIFAKHQVGPLDWKTRLKIITDVARGLAYLHSDCRQTIAHLDIKPQNILL
DEMFAAKVSDFGLAKLIDREQSTVMTRLRGTPGYLAPEWLTSIITEKVDVYSFGIVIMEI
LCGRRNLDYSQPEESQHLISMLQERAKGNQLMNLIDPRSTDMEFHIDEVLHTMNLAMWCL
QVDSNRRPSMSMVVKILEGTMSVETELDLDLVNIDLMMANRTSRWDDVTTQVESILTGPR
Download sequence
Identical sequences C5Z4I0
XP_021304362.1.57931 4558.Sb10g021740.1 jgi|Sorbi1|5031759|Sb10g021740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]