SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_021311659.1.57931 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_021311659.1.57931
Domain Number - Region: 51-135
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.0216
Family SGL-like 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_021311659.1.57931
Sequence length 339
Comment uncharacterized protein LOC8078503 [Sorghum bicolor]; AA=GCF_000003195.3; RF=representative genome; TAX=4558; STAX=4558; NAME=Sorghum bicolor; cultivar=BTx623; AL=Chromosome; RT=Major
Sequence
MESKPTDDIGSLAASFPLLVYDHGEQPDNSQTLLSVADGSSHTYRVPELRGGYRCLETPR
GLVLVADTTSFLSYLWNPQTGETITLPAMDKALPEDCRCLLSDTVSSPDCLVLVYDLTDP
ELLFCRVSGGCAWISQSYDIGLYKLPADAESYSVSAATKKAISNMAAVQGRFYIMETLDE
VGVLSFARHPDQPPHLELTSFGAPMPTMDSEAPQVATMTYLLESDQDLFLVCIFFLGCSL
ERIEEVGAYKMDFSRKEWCKVTDIGDRAFLLGAHSFAASCSAEEHGLKRGCVYFALDFFG
DSNDYHIFDLQEGTRQLAGPPKDVPLPAREPFWMVPVFP
Download sequence
Identical sequences C5XNJ2
jgi|Sorbi1|5052617|Sb03g004820 XP_021311657.1.57931 XP_021311659.1.57931 4558.Sb03g004820.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]