SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_021324046.1.45394 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_021324046.1.45394
Domain Number 1 Region: 1-54
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 2.86e-22
Family Tudor domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_021324046.1.45394
Sequence length 619
Comment lamin-B receptor isoform X1 [Danio rerio]; AA=GCF_000002035.6; RF=reference genome; TAX=7955; STAX=7955; NAME=Danio rerio; AL=Chromosome; RT=Major
Sequence
MPPARFQIGDTVMGRWPGSNLYYEVKVMSFDNKTRLYTVIYKDGTELELKESDITSVVIF
QTAGRSRSRSRSPGRSPGRSSARSPGRPRRSRSRSPARTPRRASSRSTEVRKEKLKEVLE
VRLTPVAMKHENNSSNSKSEKKEENNTAKAAPVVTEEKTETESENQTGGRYNLRRRKDQG
DGKAVELEKAVESEPLLQTKAPAAVKTADLEFGGRVGVLFLMFLLPVAVLVLLILCGQKD
ASLQSFPLELPALQSVWDCQVFGIVLLWLLFQAFLSLLPVGKLVEGMPLKNGKTLKYRIN
GFYALLLTAVAAGVAVYQEVDLSYIHAHFLQFYTSALLIATLLSIYLFIRSRWASKDELA
PGGNSGYIIYDFFMGRELNPRIKSFDIKFFCEMRPGLMGWVLINFAMLLAEMKQQNLENP
SPAMLLVNIFQLLWVIDGLWHEEKLLTMMDIMYDGFGFMLTFGDLAFVPFTFTCQAYYLV
NHPNELSVFWIITLIAMNGVGYYIFRKANSQKFAFRKNPSDPAVSHLKTIPTATGKSLIV
SGLWGFVRHPNYLGDIIMALAWSLPCGFNNLVPYFYLIYLVTLLVHRNARDERQCRKKYG
SAWEEYCKAVPYRIFPRVY
Download sequence
Identical sequences Q5RJ97
ENSDARP00000015055 ENSDARP00000104747 7955.ENSDARP00000015055 ENSDARP00000015055 XP_021324046.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]