SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_021324055.1.45394 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_021324055.1.45394
Domain Number 1 Region: 177-286
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.09e-16
Family Ypt/Rab-GAP domain of gyp1p 0.018
Further Details:      
 
Domain Number 2 Region: 35-164
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.0000157
Family Ypt/Rab-GAP domain of gyp1p 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_021324055.1.45394
Sequence length 294
Comment TBC1 domain family member 7 isoform X1 [Danio rerio]; AA=GCF_000002035.6; RF=reference genome; TAX=7955; STAX=7955; NAME=Danio rerio; AL=Chromosome; RT=Major
Sequence
MADDPQRNFRSAYYEKVGFRGVEEKKSLEILLKDNPLDVEKLSTFSQRFPLPSMYRIHVW
KVLLGILPPHSDSHALVRQYRVDQFEDVSCALTVMRFIHASTPQTEIYLRMFQLENHTLP
RRTELRPPDAEDENFLAIARAMEEIVDDPVDCFWLVRCFINQFKHKFGDSIPHLPKSLEH
FLSQEDVCLLSHLKASGALALLPYSLWFRRCFAGCLPESSLQRVWDKVISGSCKILVFVA
VEILLSHKIVIMGMNQPDAIYHFLSNMPQENTDAIVTKAIDLWHKYCGTPMHSV
Download sequence
Identical sequences F1QRX7
ENSDARP00000040264 7955.ENSDARP00000040264 ENSDARP00000040264 XP_021324055.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]