SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_021325566.1.45394 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_021325566.1.45394
Domain Number 1 Region: 140-272
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 9.55e-45
Family Synaptotagmin-like (S variant) 0.0000059
Further Details:      
 
Domain Number 2 Region: 279-415
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.41e-40
Family Synaptotagmin-like (S variant) 0.00000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_021325566.1.45394
Sequence length 430
Comment synaptotagmin-2 isoform X1 [Danio rerio]; AA=GCF_000002035.6; RF=reference genome; TAX=7955; STAX=7955; NAME=Danio rerio; AL=Chromosome; RT=Major
Sequence
MKWNVLKKKPAAMVGPEPTGASALTMAPAVSTPADNSTEHQGPVSKNDVFGDIKNKFLNE
MDKLPLPPWAIIAIAIVAVVLILTCCFCIVKKTCLKKKKGKKGKKGKGDMGMKNMKGGEK
QEEDDDEEDIDMGITEEKEEEPKEKEKLGKLQFSLDYDFSASQLTVGILQAADLLSMDSG
GTSDPYVKVFILPDKKKKYDTKVHKKTLNPVFNETFHFKIPFTEMGGKTLVMSVYDFDRF
SKHDVIGEVKIPMNTLDLAQPIEQWRDLDSAEKEEPEKLGDICISLRYVPTAGKLTICIL
EAKNLKKMDVGGLSDPYVKIHLLQNGKRLKKKKTTVKKNTLNPYYNESFSFEIPQDQMQK
IQAVITVLDYDKIGKNDAIGKIWVGSKAQGTELRHWSDMLANPRRPIAQWHPLKPEEEVD
ATLAALTAKK
Download sequence
Identical sequences F1R5C0
XP_021325566.1.45394 XP_696277.2.45394 ENSDARP00000029018 ENSDARP00000029018 ENSDARP00000121161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]