SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_021326976.1.45394 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_021326976.1.45394
Domain Number 1 Region: 373-557
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.31e-54
Family SPRY domain 0.001
Further Details:      
 
Domain Number 2 Region: 8-81
Classification Level Classification E-value
Superfamily RING/U-box 3.31e-21
Family RING finger domain, C3HC4 0.0077
Further Details:      
 
Domain Number 3 Region: 142-206
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 4.12e-16
Family B-box zinc-binding domain 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_021326976.1.45394
Sequence length 558
Comment tripartite motif-containing protein 16-like [Danio rerio]; AA=GCF_000002035.6; RF=reference genome; TAX=7955; STAX=7955; NAME=Danio rerio; AL=Chromosome; RT=Major
Sequence
MAEANISVAEDQFNCSICLDLLREPVTIPCGHSYCMNCITDYWNQNDQRRVYSCPQCRET
FTPRPALNKNVMFAEIVQKLRGASFQTAPALSYAGPGDVECDVCTERKYKAVKSCLACLQ
SYCQTHFERHEEFHSGRHKVTKATGQLKQMICPKHDKLLEVYCRTDQKCICLLCTVDEHK
NHDTVSTTSERTDIQKQLEETQAHFQQKIQEREKRMQELKDAVKTNRHLAQAAEKDSEEI
FAELIRFIERSRSEVIWRIRNQEKDAKSEVEGLLKELEQEIEDLKWRNTELEQLLHTDDH
IHFLQRFQSLCEPSKMTDISRANVSSVLLNEDVGRSVSQLKEKLEQFCKEEIENIFYKEA
KINRAYQTEPKTRKDFLQYFLQLSLDRNTAHQSLCLSEGNTVATYTHTAQHLPDHPDRFT
NFFGVLCRESVSGRCYWEVESIGNERLYGVGVAVSYKSINRKGTRTTSGFGYNDQSWKMI
CSRSRYIFWHNNIKTKLPALFRSSRIGVYVDHRAGVLSFFSVSDTTMNLIHRVQTTFTQP
LYPGFWIDPGSRLKICRL
Download sequence
Identical sequences B0S6R8
ENSDARP00000056305 ENSDARP00000056305 7955.ENSDARP00000056305 XP_017207758.1.45394 XP_021326976.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]