SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_021330984.1.45394 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_021330984.1.45394
Domain Number 1 Region: 216-466
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.57e-59
Family Voltage-gated potassium channels 0.00061
Further Details:      
 
Domain Number 2 Region: 90-187
Classification Level Classification E-value
Superfamily POZ domain 1.67e-25
Family Tetramerization domain of potassium channels 0.00000592
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_021330984.1.45394
Sequence length 545
Comment potassium voltage-gated channel subfamily A member 1-like [Danio rerio]; AA=GCF_000002035.6; RF=reference genome; TAX=7955; STAX=7955; NAME=Danio rerio; AL=Chromosome; RT=Major
Sequence
MFNGLEMEIALVSFEKRGDGESYQNQNSLDHPRLVHNKEVFPRSPQQSSWKMNDMNSTIM
GSTENTVDYYSPHLFEEDILDMDLDHENNERVLINIAGLRFETQLGTLNQFPDTLLGDPD
KRIKYFDPLRNEYFFDRNRPSFDGILYFYQSGGKIRRPVNVSIDVFADEIRFYQLGEEAM
DRFREDEGFIKEEEKPLPQNEFQKQVWLIFEYPESSSPARGIAIVSVIVITISIITFCLE
TLPEFRDERELPVTSRAVNGTQERPSLTFTDPFFIIETTCVIWFTFELFVRFFACPSKSE
FSKTIMNIIDIMSIMPYFITVGTELAEQQGQEHNNGQQAMSLAILRVIRLVRVFRIFKLS
RHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVFFAEADEPESHFSSIPDAFWWA
VVTMTTVGYGDMRPVTVGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDQDQASL
RDEPNNGGTSNQSDDLHGLRKSSKDVERNEDSNTPVEKSNTKANSRMDIKRSLYAFCLDT
RETDL
Download sequence
Identical sequences XP_021330984.1.45394 ENSDARP00000082910 ENSDARP00000082910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]