SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_021334851.1.45394 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_021334851.1.45394
Domain Number 1 Region: 492-770
Classification Level Classification E-value
Superfamily NHL repeat 2.09e-46
Family NHL repeat 0.0000146
Further Details:      
 
Domain Number 2 Region: 338-433
Classification Level Classification E-value
Superfamily E set domains 2.47e-20
Family Filamin repeat (rod domain) 0.0038
Further Details:      
 
Domain Number 3 Region: 117-178
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 8.7e-16
Family B-box zinc-binding domain 0.0018
Further Details:      
 
Domain Number 4 Region: 22-92
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000773
Family RING finger domain, C3HC4 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_021334851.1.45394
Sequence length 772
Comment NHL repeat-containing protein 3 isoform X1 [Danio rerio]; AA=GCF_000002035.6; RF=reference genome; TAX=7955; STAX=7955; NAME=Danio rerio; AL=Chromosome; RT=Major
Sequence
MSVTMAKFETGRTSPVVRQIDKQFLVCSICLDHYHNPKVLPCLHTFCERCLQNYIPPQSL
TLSCPVCRQTSILPEKGVAALQNNFFITNLMEVLQRDSECSRPEACSVLESVSAAAAGKP
LSCPNHEGKVMEFYCESCETAMCLECTEGEHREHVTVPLRDVLEQHKAVLKNQLDAIRNR
LPQLTAAIEMVNEISKQLTERKNEAVNEINMTFEELERALHQRKAALITDLENICSTKQK
VLQAQLSSLLQGKEHIQSSCSFTEQALSHGSATEVLLVQKQMSERVSALACHDFPERPHE
NAHLDCQIETEGLRRSIQNLGVLLTTGAVGHTSVATGEGLRHALVGQHVTVTVTTKDKDS
ELVRTGNAALRAEIMGQDGAQVTEAEVVDNKNGTYEVGYTLKGEGEYLFSLILYGQPVRG
SPFKLRAIKPSDVPQSPDDVKRRVKSPSGTGGHIRQKAVRRPSSMYSTTKKKENPIEDEL
IYRVGTRGREKGEFTNLQGISASISGRVIVADSNNQCIQVFTNDGQFKARFGVRGRSPGQ
LQRPTGVAVDTNGDVIVADYDNRWISIFSPDGKFKNKIGAGRLMGPKGVAVDRNGHIIAV
DNKACCVFIFQSNGKLVTKFGARGTSDRQFAEKSGSKCALEQKFSKSGPGFSPHFVAVNN
KNEIVVTDFHNHSVKVYSADGEFLFKFGSHGEGNGQFNAPTGVAVDVNGNIIVADWGNSR
IQVFDSAGSFLSYINTSADPLYGPQGLALTSDGHVVVADSGNHCFKVYRYLQ
Download sequence
Identical sequences E7F959
XP_005155434.1.45394 XP_005155435.1.45394 XP_009303590.1.45394 XP_021334851.1.45394 ENSDARP00000101294 ENSDARP00000101294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]