SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_021340916.1.56386 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_021340916.1.56386
Domain Number 1 Region: 29-154
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000222
Family Spermadhesin, CUB domain 0.0047
Further Details:      
 
Domain Number 2 Region: 158-189
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000942
Family LDL receptor-like module 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_021340916.1.56386
Sequence length 234
Comment neuropilin and tolloid-like protein 1 isoform X2 [Mizuhopecten yessoensis]; AA=GCF_002113885.1; RF=representative genome; TAX=6573; STAX=6573; NAME=Mizuhopecten yessoensis; strain=PY_sf001; AL=Scaffold; RT=Major
Sequence
METLAIVCILAWMLAYTSALQTYYMEEGCGASINMMTRNEDSIILRLSRNPTHRPNQDCV
VAIEPPLGKDISVTFRDLDVESGPTGQCTTDFVRMYDGRSGQAQFVQGLPQTICGNSNMM
LTRSYETRLGYLTVQFQSRSQIVNRRGFELLISAFRRGPCQGGETQCYNGRCINNNLRCS
GYDHCGDGTNLCPLPLEASVALGVGGIVVLVVIIAVIGVCIYKKKRSSSMKDEY
Download sequence
Identical sequences XP_021340916.1.56386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]