SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_021347030.1.56386 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_021347030.1.56386
Domain Number 1 Region: 32-294
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.23e-48
Family Ankyrin repeat 0.00033
Further Details:      
 
Domain Number 2 Region: 359-400
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000405
Family SOCS box-like 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_021347030.1.56386
Sequence length 453
Comment uncharacterized protein LOC110446288 isoform X2 [Mizuhopecten yessoensis]; AA=GCF_002113885.1; RF=representative genome; TAX=6573; STAX=6573; NAME=Mizuhopecten yessoensis; strain=PY_sf001; AL=Scaffold; RT=Major
Sequence
MPDICLSPSNAQLQKMMKKRLSLAPVAKEFVDFIHAGDHKNVKRMIKERVVDVNLRDTED
PVLPTPLLIAAEMNDEEMVRLMLRAKPKPANINDETTKGKRAIWIAAKHGNVEMVEYLLN
GKSPCEVNIVDKESGCSPLFRAILTESAEACQLLIKAGADVNLRRLSLENSNETPLIKAI
QMDNRDICQILVNSLCKLQTKTDAGLNALHFAVAYCRYDIVELLMENGVKIHAKSNAGIT
AMSVAIENHNAAMVKILLKKGYKVDKKYKWKETPLQQAIKLHATESALTLMHHGCTVKKD
KGSSYMHMAVEEKLIRIIKFLIALNPLFLNEEWLQKQMWPVSLYRRPDIFNWLQKEAATP
RTLKQLCRARIFKLLGTYAPAKAKELPLPETLREYLQYNEFVKDEYYKQKPLNSKECPFD
CPAKCSYRHCPPIEVSASESESESDSDVEIDSS
Download sequence
Identical sequences XP_021347029.1.56386 XP_021347030.1.56386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]