SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_021353392.1.56386 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_021353392.1.56386
Domain Number 1 Region: 12-54
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000000000141
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_021353392.1.56386
Sequence length 226
Comment ropporin-1-like protein [Mizuhopecten yessoensis]; AA=GCF_002113885.1; RF=representative genome; TAX=6573; STAX=6573; NAME=Mizuhopecten yessoensis; strain=PY_sf001; AL=Scaffold; RT=Major
Sequence
MPTNPDEPYYCSQQINIPPSLPDILKQFTKAAIRTQPKDVLAWSAAYFRAMSKGETPPVK
ERLEMPVATQKTDTGLTPGLLRVLNKQLGPKKMVPLSVVEEKWQDVALPKEQFDEIVRIG
SFGGDVEWNKFFTLACSALGENLTDALKLVCEILTADPEGGPARIPFPLFKELYTYLAQI
DGDISQGHIDDTISHLKYDVDKQDGYIQPRNFLSPDGPKLSMQTTS
Download sequence
Identical sequences A0A210QPC1
XP_021353392.1.56386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]