SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_021356555.1.56386 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_021356555.1.56386
Domain Number 1 Region: 672-794
Classification Level Classification E-value
Superfamily I/LWEQ domain 2.06e-46
Family I/LWEQ domain 0.0000121
Further Details:      
 
Domain Number 2 Region: 498-662
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 8.37e-46
Family A middle domain of Talin 1 0.000016
Further Details:      
 
Domain Number 3 Region: 764-899
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.79e-45
Family I/LWEQ domain 0.0000123
Further Details:      
 
Domain Number 4 Region: 1856-1983
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 3.3e-34
Family VBS domain 0.0000965
Further Details:      
 
Domain Number 5 Region: 1236-1372
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 5.65e-32
Family VBS domain 0.014
Further Details:      
 
Domain Number 6 Region: 196-310
Classification Level Classification E-value
Superfamily Second domain of FERM 3.27e-29
Family Second domain of FERM 0.00000922
Further Details:      
 
Domain Number 7 Region: 311-401
Classification Level Classification E-value
Superfamily PH domain-like 4.92e-25
Family Third domain of FERM 0.0000405
Further Details:      
 
Domain Number 8 Region: 1086-1218
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.11e-19
Family VBS domain 0.038
Further Details:      
 
Domain Number 9 Region: 1479-1566
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.000000000000471
Family I/LWEQ domain 0.0076
Further Details:      
 
Domain Number 10 Region: 1703-1824
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000000345
Family VBS domain 0.031
Further Details:      
 
Domain Number 11 Region: 2017-2136
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000235
Family VBS domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_021356555.1.56386
Sequence length 2150
Comment talin-1-like isoform X6 [Mizuhopecten yessoensis]; AA=GCF_002113885.1; RF=representative genome; TAX=6573; STAX=6573; NAME=Mizuhopecten yessoensis; strain=PY_sf001; AL=Scaffold; RT=Major
Sequence
MATLSLKISVVGNNVVKTMQFEPSTLVYDACKIIRDKLVEIQQGNTGDYGLFLKDDDPKK
GVWLESGRALDYYLLRNGDLLEYRKKLRILQIKTLEGNQKKLQVDDSHTVGQLMVTICTR
IGIANHEEYSLVRDLADDEKEKTMTIKRDKSIAKDQKKLEEMRKKLHTDDELEWLDHSKT
LREQGVNDEDTLLLRRKYFYSDQNVDQRDPIQLNLLFVQSRDAILDGTHPVAQEEAIQFA
GLQCQIQFGNHIENKHKSGFFELREFLPKEYCKIKGIEKKIFAEHKKWTGLSEYEAKAKY
TQQCRALKTYGITFFLVKEKMPGKNKLAPRLLGITKESVVRMDEKTKEVMKTWPLTTVRR
WAASPNSFTLDFGDYSDAYYSVQTQEGEQISRLIAGYIDIILKRKKAKEHLGIDGTDEAP
MYEDNVAPGQATIIKQNQAKVSHADHMSVSMPGVMRSGVGPSNFSAGSMDSMQSSQVSNS
MHVRHENNQSQGVHEFSLTSSQRALISSIDEGVSSIRRDQSTLDSRMTLPHLGDDAASNK
WRQNQLDLSRQKVSAQLAAMNAATAQLVTLSAGDDEPDTDNVGAAVAQITSNMGDFSHDV
RMVAALQDDDDSRSRLLGAAKQLAGAFTDLLNAAQPGPNAKDSRQNLIMAAKTVGEASQE
VMHGVGESALDMDRQYQETLLALAKAVANATAQLVLKAKNVASTTEDQAQRDKVISSATS
CALATSQLVSCTKVVAPTISSPACQEQLIDAAKQVARSVEGIVEAAQQACKEDKLLQDLG
AAATAVTQALTDMLEHIKKGAGPTQASDSHEVAVDTILTVTDRLFSSVGDAHEMVKQARQ
LAQATSNLVNAIREQAEDNSDTDTQKRLLAAAKALADATAKMVEAAKGCATNPNDAMQQH
GLKTAAEDLRAATNVAASNALKKRIVMKLEHAARQAATAATQLINASSSANKTNTNTMSQ
QQLSQYCKEVNEQLPKLVQGFHGSMNNTDSASAQLNLINASQDFIQPAGGLVSAANAAAP
TVNDQASARNMNQSCKAMSNALAELRTAAARAQEAYGSLEVDSALDHLTSLDRELEECRR
AAESGGLVPLPGETAETSAQKLGTTSKSVGSAMAQLLTAASQGNDNYVGIAARDTANVMR
VLTDATRGVAATTEDRQVQLLVIDSARDVIDKSTRLLEEAKLALNNPDNPDNQTRLNQVA
KAVSNALNNCVSCLPGQRDVDNAVRHIMESSQALTTSEYPSSSKSFLEVQGDMNDSAVNL
NQAASDIVTSSRCTAQELASSSNRYSSTYHTFVQTGLTMAGKSKDTETQSQIVGGLKSVS
MVSSKLLLAAKSVLADPNAPNAKNLLQQAARSVTESINQLITICTVSAPGQKECDNALRQ
IEVMRSLLDGANEPVSDMTYFECLESVMEKSKALGEAMTGITNHAKQGELDDFCVAVHNF
AGSVCGLTEASSQAAYLVGVSDPNSEPGRPGLVDQSQFARANQAIQSACANLANPASSQQ
QVLSAATIVAKHTSALCNACRLASSKTSNPVAKRHFVQSAKDVANSTANLVKAIKALDSE
FTEENRERCAEAAKPLIEAVDELTKFASSPEFASVPARISPQAKKAQEPITSAGNAMISG
ACSMVQAAKQLAVNPKDPPTYQLYSNYSKSVSDAIKRLVSSIRDSAPGQRECDDSTDKLN
HSIRTLDQAALSAISQSLQQRQDKTLKAFQEQMISSARQIQEHVDQVRVSAKEEPENLGH
RVTVMASYFDPLADGAVGVASLVTNSKQQTQIIDLTKTVAESTLQFVYSCKEGGGNPKAF
HTHQNIDTAAENTKDVLQDLLQSLEEAASQAGMVNSMIEKISKSISRTDERVTIQEDRNY
VDYQTNMVRLAKNIAMTTQDMVGKSSTSVSELGRLANQLTRDFDLLANDSRGAAASTASS
DVANRIRTTVQDLGKCCIELVQDAGKLQSNSSDTFARRDLADHARSVNEKVSFLLASLQA
GSRGTQACINAASTVSGIIADLDTTIMFATAGTLNSDTADSFADHRENILKTAKALVEDT
KTLVAGAASNQEQLAGAAQMAVKTITRLADVVKFGAASLGSDQPDAQVMIINAVKDVASA
LSELISATKNASGKSVQDPAMLHLKESAKSADDLISSIAGGYHVYVSSML
Download sequence
Identical sequences XP_021356555.1.56386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]