SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_021384885.1.53032 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_021384885.1.53032
Domain Number 1 Region: 532-648
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.31e-29
Family UBX domain 0.0000284
Further Details:      
 
Domain Number 2 Region: 333-488
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000313
Family Glutathione peroxidase-like 0.085
Further Details:      
 
Domain Number 3 Region: 90-177
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000473
Family Ubiquitin-related 0.046
Further Details:      
 
Domain Number 4 Region: 185-257
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000367
Family Ubiquitin-related 0.039
Further Details:      
 
Weak hits

Sequence:  XP_021384885.1.53032
Domain Number - Region: 6-42
Classification Level Classification E-value
Superfamily UBA-like 0.00561
Family TAP-C domain-like 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_021384885.1.53032
Sequence length 650
Comment FAS-associated factor 1 isoform X1 [Lonchura striata domestica]; AA=GCF_002197715.1; RF=representative genome; TAX=299123; STAX=40157; NAME=Lonchura striata domestica; AL=Scaffold; RT=Major
Sequence
MASNMDREMILADFQACTGIENIDEAITLLEQNNWDLVAAINGVIPQENGILQSEYGVET
LHGPAYGPSSHSAAASSAPSSSSAFRHVVPSRQIVERQPRMLDFRVEYRDRNVDVVLEDS
STVGDIKHILENELQIPASKMLLKGWKTGDVDDSTVLKSLHLPKNNSLYVLTPDLPPPSS
SHSGALQESLNQNFMLIVTHREVQREYNLNFSGSSTIQEVKRNVYDLTSIPVRHQLWEGW
PSSATDDSMTLAVSGVTFPCHRLTVGRRSSPVQTREQSEEQCTDVHMVSDSDGDDFEDAT
EFGVDDGEMFGVASSALRKSPMMPENAENEGDALLQFTAEFSSRYGDCHPVYFIGSLEAA
FQEAFYGKARDRKLLAIYLHHDESVLTNVFCSQMLCAESIVSYLSQNFITWAWDMTKEAN
RARFLTMCTRHFGSVVAQTIRTQKTDQFPLFLIIMGKRSSNEVLNVIQGNTTVDELMMRL
MAAMEIFSAQQQEDIKDEDEREARENVKREQDEAYRISLEADRAKREAQEREMAEQFRLE
QIRKEQEEEREAIRLSLEQSLPPEPKEESTESVSKLRIRTPSGEFFERRFLASSKLQVVF
DFVASKGYPWEEYKLLGTFPRRDVTQLDPNKSLLEVKLYPQETLFLEAKE
Download sequence
Identical sequences A0A218VEX9 H0ZE93
ENSTGUP00000008905 XP_002193006.3.42559 XP_021384885.1.53032 59729.ENSTGUP00000008905 ENSTGUP00000008905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]