SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_021398201.1.53032 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_021398201.1.53032
Domain Number 1 Region: 124-639
Classification Level Classification E-value
Superfamily Sema domain 1.57e-98
Family Sema domain 0.0012
Further Details:      
 
Domain Number 2 Region: 1511-1636,1802-1959
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.92e-36
Family p120GAP domain-like 0.021
Further Details:      
 
Domain Number 3 Region: 1074-1164
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000458
Family Other IPT/TIG domains 0.089
Further Details:      
 
Domain Number 4 Region: 984-1064
Classification Level Classification E-value
Superfamily E set domains 0.000000000000153
Family Other IPT/TIG domains 0.011
Further Details:      
 
Domain Number 5 Region: 642-694
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000196
Family Plexin repeat 0.0023
Further Details:      
 
Domain Number 6 Region: 1163-1247
Classification Level Classification E-value
Superfamily E set domains 0.000000000967
Family E-set domains of sugar-utilizing enzymes 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_021398201.1.53032
Sequence length 2026
Comment plexin-D1 [Lonchura striata domestica]; AA=GCF_002197715.1; RF=representative genome; TAX=299123; STAX=40157; NAME=Lonchura striata domestica; AL=Scaffold; RT=Major
Sequence
MTGPRHRDAVSTGAGAGAGAGGGRGQGRGAAARPAAPRRPPPRPPLPAGVARRRALPPQE
AAPRPPLPRPATGTCTVRRGGGMAPAPLPAPAAGAEPRPPALLPLLLPLLPLLLPGRAAG
LEVQRKFLSPTLTNNFALDGPGSRVYLAAVNRLFQLSGGELALEAEAAVGPVLDSPLCHA
PQLPQASCEHPRVLTNNYNKILQPDPEQGVLVVCGSIYQGLCQLRSMANISAVAVRFPPG
GSDSVAVFPSMLNVAANHPNASTVGLVLRRGGGGGARLLVAATYTGFGSPFFPRNRSLED
HRFENTPEIAIRALNARGDLAKLFTFDINPSDDNILKIKQGDKARHKLSFVRAFLQHGAA
PPARRPYAYLALNTEANAGDKESPAHSLLARICLGEPAEATLNGSGETKKLTESYIQLGL
RCGGAADAFTRLVSVFPARAAWRSPAAPHGPALAPPPPEELLFGVFERAGAGGGRGRPQS
ALCVFRFAEIEETIRAARNSCFVSPAAGMVTVLDSVVQGTGPACEKRNIQLQPEQLDCGA
AHLQHPLAIVNPVTATPIFTHSGLTAVAVASVNNYTVVFLGTASGGLLKINLDNTMKVIS
RRSILVAYGEPVHPIMQFDPSDSTYLYLMTSYQMTRVKVAACSQYSTCTECLAAADAYCG
WCTMETRCSLQHECTNFTGANFWTSVSEGVQQCPSMTILEPEINIDKENPALIIQINGTI
PNLNGTNISCDYGNNIHTVARVAGDYVNQFIYCSLLPHEKYPAFPDDQDHVVVETSLRVN
NKNIIRANFTIYDCKRIGNIYPKRACTSCLSARWKCHWCPSAYSCVSNHSQCEDALRMEQ
KKIDCPQIVPAPLEPMPTGVSRNILISLANATFSKETALECHFGTDGTFEARWVNSSAVE
CVHVLLHTSEKSHRFPVNLQLKDKPDRFIDSPEMMTVEVYNCATGSADCSQCLGREDLGH
RCLWSESSSSCRLQTEPPQVSEVCPPPEIRKIEPLRGPLEGGTLLTVRGRNLGRRFSDIL
GAVRVGGVLCAPLPDRYVVSETVVCQTGEAPEAFSDVVTVNVSREGRSRERYSYVLPVVQ
SIAPQNGPKAGGTRVTIRGSRLDVGSELRVLINSSKQCTELSRTDSTITCTMPAVELTTA
VPVCVQFENKSCASHNITFKYEKNPVISDINPKKSQISGGRIITLEGRGFGLVQNVSMAV
RGIGREHTRCKVHTDTAITCPSPAASNLTAGSKPAPVDFYLNGRLYSDERSALDEEMYSE
EASHISKFSLGYYADPQFSTAKKEKWIKHHPGEPLTLVIHKEPDSLGLESNEYQVKIGLI
SCEIQIVSDKVIHCSINESLSSSERQLPVTIQVGKFNYTIAMLHLGGGETAIIVSIVICS
ILLVLSVVALFVFCTKSRRAERYWQKTLLQMEEMESQIREEIRKGFAELQTDMTDLTKEL
NRSQGIPFLEYKHFVTRTFFPKCSSLYEECYILPSQQLSSQVGSQVQETHPLLVGEWKIP
ENCRPNMEEGISLFSTLLNNKHFLIVFVHALEQQKDFAVRDRCNLASLLTIALHGKLEYY
TSIMKDLLVDLIDASASKNPKLMLRRTESVVEKMLTNWMSICMYSYLRETVGEPFFLLIC
AIKQQINKGSIDAITGKARYTLNEEWLLRENIEAKPRNLNVSFQGCGMDSLSVRAMDTDT
LSQVKEKILEAFCKNVPYSQWPRVEDVDLEWFATSTDSYILRDLDDTSVVEDGRKKLNTL
AHYKIPEGASLAMSLTDKKDTTLSRVKDLDTEKYFHLVLPTDESVEHKKSHRQSHRKKVL
PEIYLTRLLSTKGTLQKFLDDLFKAILSIRDDKPPVAVKYFFDFLEEQAEKRGITDPDTL
HIWKTNSLPLRFWVNILKNPQFVFDIDKTDHIDACLSVIAQAFIDACSLSDLQLGKDSPT
NKLLYAKEIPEYRKIVQRYYKQIHDMPPLSEQEMNAHLAEESRKYRNEFNTNVAMAEIYK
YAKRYRSQIVAALDANPTTKRTQLQHKFEQVIALMEDNIYESCSEA
Download sequence
Identical sequences XP_021398201.1.53032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]