SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_021399097.1.53032 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_021399097.1.53032
Domain Number 1 Region: 178-248
Classification Level Classification E-value
Superfamily Homeodomain-like 5.99e-18
Family Homeodomain 0.0000547
Further Details:      
 
Domain Number 2 Region: 54-120
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.22e-17
Family LIM domain 0.018
Further Details:      
 
Domain Number 3 Region: 22-52
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000247
Family LIM domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_021399097.1.53032
Sequence length 359
Comment insulin gene enhancer protein ISL-2 [Lonchura striata domestica]; AA=GCF_002197715.1; RF=representative genome; TAX=299123; STAX=40157; NAME=Lonchura striata domestica; AL=Scaffold; RT=Major
Sequence
MVDILLPRPLPGAMGEPSKRRPGLALCAGCGGRIQDPFLLRVSPDLEWHVACLKCAECGQ
PLDETCTCFLRDGKAYCKRDYSRLFGIKCAQCRAAFSSSDLVMRARDHVYHLECFRCAAC
GRQLLPGDQFCLRERDLLCRADHGSPPDGAAARGPRSPALPPAAAAHLAEPVPGRPPAPR
PPAHKAAEKTTRVRTVLNEKQLHTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQN
KRCKDKKKSILMKQLQQQQHSDKTSLQGLTGTPLVAGSPIRHESAVQGSAVEVQTYQPPW
KALSEFALQSDLEQPAAFQQLVSFSESGSLGTSSGSDVTSLSSQLPDTPNSMVPSPAET
Download sequence
Identical sequences XP_021399097.1.53032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]