SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_021401675.1.53032 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_021401675.1.53032
Domain Number 1 Region: 113-291
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-23
Family Clostridium neurotoxins, the second last domain 0.047
Further Details:      
 
Domain Number 2 Region: 538-613,646-664
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000000000118
Family Reprolysin-like 0.067
Further Details:      
 
Domain Number 3 Region: 1322-1396
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000598
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 4 Region: 1279-1327
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000709
Family Complement control module/SCR domain 0.0059
Further Details:      
 
Domain Number 5 Region: 1387-1445
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000208
Family Complement control module/SCR domain 0.0069
Further Details:      
 
Domain Number 6 Region: 389-479,568-633
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000212
Family Reprolysin-like 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_021401675.1.53032
Sequence length 1588
Comment LOW QUALITY PROTEIN: pappalysin-2 [Lonchura striata domestica]; AA=GCF_002197715.1; RF=representative genome; TAX=299123; STAX=40157; NAME=Lonchura striata domestica; AL=Scaffold; RT=Major
Sequence
MLRGGAPLAALLLAALSLARGEPPPVSGCGMEAPSRRAAPPHLPYGLYPQGPAAHGALGA
ASPRGRRPRGARAGGEEPQGEADGRGRGRSRWERRRGREPQVPDPPRERPLPALYFSGGR
EQLAARAEALPAVPRDEFTLELWVKAEGGQNNPAIIAGVFNNCSHSASDKGWALGIRALQ
LNGKKDARFFFSLRTDRAAAATEVTSHRRYRPEAWTHLAASYDGRWMALYVDGVRVGRSG
GQEGPLHSAFMSSCHTLLLGGDAWGTTHTFRGHLAGLALWRGALSQSHLQRSFLEEVAEE
TAGLALAAGFATPEERWAPFREGAFPQQRVLLSPPSPVLRPLGPPACGQTACDNVELAGH
YNQHWPLRSWKVLRYRVVNLAEDDGGRPTVTWEQIWRQHRALSEAFRPYNISWQLSLLDV
RNSSLRRRAVLLGCEPSKVGNERCDPECEHPLTGYDGGDCRRAGRCFSWKRRDGVCHMEC
NNMLDDFDDGDCCDPRATDVARTCFDPDSPQRAYMSVKELKEALQLNSTHFLNVYFASSV
REELAGAATWPWDKEALSHLGGVVLNPAYYGMHGHTNTMIHEVGHVLGLYHVFKGVSERE
SCDDPCRETTPSMETGDLCADTAPAPKSKLCRDPDPTNDTCGQTHFTGTPFNNYMSYTDD
DCTNSFTPNQVARMHCYLDLVYQRWGHSKKPAPIPIPAMVTGQTQHSLSIYWLPPISGVI
HEREQDTLCDSCAEDGTFRQYVHEASSPRVCDSSGYWTPEEAEGPPDVDQPCEPSLQAWS
PELHLYDMNMTVPCPQPDGCILELRFLHPVYPDSLTLWTTYLSTGSPKALSDIEILTEQG
ESIHLGPLDTFCDVPFTVKLNIPKKMSGVKIYTFDERMEIDTALLTSRPHSSLCSACRLI
QYRVLREPPFADGSPATPLQAHRQFIDTEVTPGQLYRYQVQVVSGTTSGEASPPLVHVHG
APYCGDGKVTTSLEEECDDGDLLDGDGCSRKCKKEKGFNCVGEPSLCYVHDGDGVCEPFE
ETSSMLDCGPHTPEGFVDLWAVKAYASQQDEKSCPASIVTGEPVVKVCFERPAVPTSLLL
FLASSGTVPSQQLKPVVAVQLTDTDGQNRSLGTYELSCQHTPLTINVTHSQEDPLPQVAS
VLLNFSSPLVGIAAVALRTLAQPGSSDPLTSCLLQHHYEGXVCTHGACVGLGICTQPLLA
HAATLNCSLDGPRHMMCAVSCEKGFVLHSSGGKRLGSWQQEVVLTCRSGQWDRSVTCDPV
DCHVPDQSHVSYAEFSCPLGTTYLQRCSFSCIPPAKLQGTNQWLTCLEDGLWSLPEAYCK
LECAAPPAVANARLLVPRCLQGSHDVGSVCRYKCKPGYHVAENTADKPKRKFLKVQCLES
GQWEEGHCVPVVCKPPPPVFEGMYNCTQGFELDSQCVLNCEQQGQQVPIVCTKEGLWTEE
FKLCESLQGTCPPPPELNFVEYKCEQGHGIGAVCIPSCVIPPSDPVILPKNVTAETMDHR
LQPTRVQNIVCTGRLRWYPDPSVIHCIQSCEPFQADGWCDTINNRAYCQYDGGDCCSSTL
SSRKVIPFAADCDQDECTCRDPAAEENQ
Download sequence
Identical sequences XP_021401675.1.53032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]