SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_021412573.1.32639 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_021412573.1.32639
Domain Number 1 Region: 476-611
Classification Level Classification E-value
Superfamily TIMP-like 1.33e-24
Family Netrin-like domain (NTR/C345C module) 0.023
Further Details:      
 
Domain Number 2 Region: 247-343
Classification Level Classification E-value
Superfamily Immunoglobulin 1.26e-19
Family I set domains 0.011
Further Details:      
 
Domain Number 3 Region: 429-482
Classification Level Classification E-value
Superfamily BPTI-like 4.26e-17
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0023
Further Details:      
 
Domain Number 4 Region: 365-424
Classification Level Classification E-value
Superfamily BPTI-like 0.000000000000044
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.026
Further Details:      
 
Domain Number 5 Region: 164-215
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000305
Family Ovomucoid domain III-like 0.04
Further Details:      
 
Domain Number 6 Region: 72-121
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000523
Family Elafin-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_021412573.1.32639
Sequence length 618
Comment WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein-like [Oncorhynchus mykiss]; AA=GCF_002163495.1; RF=representative genome; TAX=8022; STAX=8022; NAME=Oncorhynchus mykiss; AL=Chromosome; RT=Major
Sequence
MTFMKVPFKMNISSLSCRGVGGGKNVDTNQPKALIYPKGLLSGRVGWSSLVFLVCLCVFP
QQTWSASLAGSKLEHPGVCPNKLNANLWVDAQSTCERECEVDEDCAGFEKCCTNVCGLFS
CVAARFSDGTPAQPDGQGGGEKGPGGQGSIATCQGFICSQQGATCDIWEDQPICKCQDHC
EKDPSFTCASDGLTYFNKCYMDAEACTQGVTLTVVTCRFHLSGPQTSPLPQDTTANPTLT
SFLEDPIPPTLFSNPSHQSVYIGGTVSFHCDVMGVPRPVVTWEKQSERHESLVMRPDRMY
GNVVITNIGQLVVYNAQVWDTGIYTCVARNAAGVLRADYPLSVIRRTEDDIFSEDPEMAG
MPMGPPFSPADCLAELDRRECSAERYVDWYYDAEQGTCLAFSNGGCDDSRNRFETYEECQ
ASCQREGMGICSLPAVQGPCKSWEAHWAWNSLLKQCQAFAYGGCQGNSNRFRSKKECEAN
CPQSKRRVCKTCRVKGKIVPSLCRSDFAIVGRLTELIEDLDSGIARFSLEKILRDEKMGL
AFFNTRHLEVTLAKMDWSCPCPNITMEEGPLLVMGDVQDGMAVIHPDSYVRPISDKRLKR
IHEVLEKRTCEMLQRFRD
Download sequence
Identical sequences XP_021412573.1.32639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]