SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_021422422.1.32639 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_021422422.1.32639
Domain Number 1 Region: 35-517
Classification Level Classification E-value
Superfamily Sema domain 9.42e-100
Family Sema domain 0.00071
Further Details:      
 
Domain Number 2 Region: 1385-1508,1674-1859
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.46e-34
Family p120GAP domain-like 0.029
Further Details:      
 
Domain Number 3 Region: 858-949
Classification Level Classification E-value
Superfamily E set domains 0.000000000000484
Family Other IPT/TIG domains 0.041
Further Details:      
 
Domain Number 4 Region: 1041-1120
Classification Level Classification E-value
Superfamily E set domains 0.0000000000509
Family E-set domains of sugar-utilizing enzymes 0.068
Further Details:      
 
Domain Number 5 Region: 949-1021
Classification Level Classification E-value
Superfamily E set domains 0.000000000109
Family Other IPT/TIG domains 0.035
Further Details:      
 
Domain Number 6 Region: 520-572
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000732
Family Plexin repeat 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_021422422.1.32639
Sequence length 1898
Comment plexin-D1-like [Oncorhynchus mykiss]; AA=GCF_002163495.1; RF=representative genome; TAX=8022; STAX=8022; NAME=Oncorhynchus mykiss; AL=Chromosome; RT=Major
Sequence
MPPSEKIAVLILGVLVLESPWNAHHSLASALQIQQAFASQNQTNNFVVDEVSRKVYLATV
NMVYQLNGTLSVEVEKRTGPVEDNLLCHAPQLPQAPCEHPKSLTDNFNKLLELDREQGVL
VVCGSVYQGFCELRKMENISEIAVEFPPHGEKTVFPSMLNIAANHPNASTVGLIFRSHGG
NTRLLVGATYTGAGTQFFPKNHSKEDLRFENTPEIAIRSLNINDLSRLFTYDINPSEDNV
FKIKQEVKQKNKLNFVHAFIQKTYAYIAINNDANMGHKQSQPNSILARLCLDTENTRKST
SESRKLTESFIQMPLQCGYNGNIYNRLVSVHPAEIHSGSGEGLESHLFGVFTKSDRKSAL
CAFRFSDIEEEIRQGRRNCSNSPSSDVQVLDSVIQGSGAACVHKGNLVLQPEQLDCGAAH
LQHPLALRRPLRATPLFESLGLSSVAVDNIHNHTVVFLGTSTGRLRKLTLLKNLTVANQW
ALKLPAGESVHHIMTFDPLDRNYLYLMTSHHLLRVKVAACGQYRSCSDCLGAGDAHCGWC
TLESRCSIQRECSGGLMVRSWIGMGEGPQQCPSMTLTPQEISLSADIKDVGILINGSVPD
LVGSRVECDYGLGVATVATVHLDYGPAQIQTCPLLPRERYPHIPPGRDHLMVPVAIKVNG
TSVVSGTFLIYDCERTGAIHPKIACISCLSTRWRCYWDQNSHSCLSTKDDSKPSLLENSA
SCPSLVAKDVPPSPSGITQDFTLSLSNVEQQEELECDFGSEQRYEARWLNSVSEVKCSGV
MLTTAERSQVFHLSLRRKGHLDKYIDSPKPMTVEVYNCGVGSGDCSQCWGREDQGHLCGW
CDNICRTRDDCQYMSSQCPDPEITKISPLSGPLEGGTLLTVQGRNMGRRADVVKVSIGMV
PCKILPYRYTVSVQLVCVTGQTFDPTNYVVRVTVNQNAMGVSKEVFSYLVPKLLSMEPRK
GSRSGGTRVTLRGEYLDTGSQVRVKVNGTQDCTILTLTKDTIECTIPAALHTHTEAVSVC
VEFEDIPCQSAELLTQYIYEKNPTISYIKPRKSYLSGGRTITVTGQGFDLVQSVSMEVLG
IGQDACKVQSPSMITCSSPASSQSQQATVEFLLNGVLYTGDGPAFDGPDQEEEEEPHGGH
FLLEYVEDPQFFTANKEKLIKHHPGEPLTLIINKGPSDLELAPEEYSVMIGSYPCDISFH
NNQLFHCTINGSLGSSEGELPVTVRVGNFERIIAKVQLGGSELAIVVSIVVCCVLLLLCT
VALVVYCTKSRRAERYWQKTLLQMEEMESQIRDEIRKGFAELQTDMTDLTKELNRSQGIP
FLEYKQFVTRTFFPKMCSDYERSLVQPVYENDALGPRALPETHPLLQDWQPSNTAKPNME
EGITLFSTLLNNKHFLVTFVHALEQQKDFAIRDRCSLASLLTIALHGKLEYYTSIMKDLL
VDLIDASAAKNPKLMLRRTESVVEKMLTNWMSICMYSYLKETVGEPFFLLLCAIRQQINK
GSIDAITGKARYTLNEEWLLRENVEAKPQNINVSFQGCGMDSLAVKVVNTDTICQVKEKI
LEAFYKNLPFSQWPRAEDVDLEWFASGSNSRILQDLDNTSVMEDGRKKLNTVTHYQIPEG
ASFAMSMKDKRDNTLGRAKDLDTEKYVHLVLPHDEPFENKKSHRQSHRKKVLPEIYLTRL
LSTKGTLQKFLDDLFQAILSIPAERPPLAIKYFFDFLEEQADKRGITDPDTLHIWKTNCL
PLRFWVNILKNPQFVFDIEKTDHMDACLSVIAQAFIDACSVSDLQLGKDSPTNKLLYAKE
IPEYKKRVQCYYKQIHEMAPLSEQEMNAHLAEESRKYRNEFNTNLALTEIYKYAKKYRNQ
VVSALESNPTAKRTQLHHKFEQVIALVEDNIYECSSEA
Download sequence
Identical sequences XP_021422422.1.32639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]