SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_021423448.1.32639 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_021423448.1.32639
Domain Number 1 Region: 467-602
Classification Level Classification E-value
Superfamily TIMP-like 9.42e-25
Family Netrin-like domain (NTR/C345C module) 0.023
Further Details:      
 
Domain Number 2 Region: 238-334
Classification Level Classification E-value
Superfamily Immunoglobulin 1.68e-19
Family I set domains 0.011
Further Details:      
 
Domain Number 3 Region: 420-473
Classification Level Classification E-value
Superfamily BPTI-like 4.11e-17
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0023
Further Details:      
 
Domain Number 4 Region: 356-415
Classification Level Classification E-value
Superfamily BPTI-like 0.0000000000000454
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.026
Further Details:      
 
Domain Number 5 Region: 156-206
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000166
Family Ovomucoid domain III-like 0.04
Further Details:      
 
Domain Number 6 Region: 63-112
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000471
Family Elafin-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_021423448.1.32639
Sequence length 609
Comment WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein-like [Oncorhynchus mykiss]; AA=GCF_002163495.1; RF=representative genome; TAX=8022; STAX=8022; NAME=Oncorhynchus mykiss; AL=Chromosome; RT=Major
Sequence
MNISSLSRRGVGGGKNVDTNQPKALIYPKGLLSGHVGWSSLVFLVCLCVFPQQTRSASLA
GSKVEHPGVCPNKLNANLWVDAQSTCERECEVDEDCAGFEKCCTNVCGLFSCVAARFSDG
TPAQPDGQGRGEKGSGGQGSIATCQGFICSQQGATCDIWEGQPICKCQDHCEKDPSFTCA
SDGLTYFNKCYMDAEACTQGVTLTVVTCRFHLSGPQTSPLPQDTTANPTLTSFLEDPIPP
TLFSNPSHQSVYIGGTVSFHCDVMGVPRPAVTWEKQSERHESLVMRPDRMYGNVVITNIG
QLVVYNAQVWDTGIYTCVARNAAGVLRADYPLSVIRRTEDDIFSEDPEMAGMPMGPPFSP
ADCLAEVDRRECSAERYVDWYYDAEQGTCLAFSNGGCDDSRNRFETYEECQASCQREGMG
ICSLPAVQGPCKSWEAHWAWNSLLKQCQAFAYGGCQGNSNRFRSKKECEANCPQSKRRVC
KTCRVKGKIVPSLCRSDFAIVGRLTELIEDLDSGIARFSLEKILRDEKMGLAFFNTRHLE
VTLAKMDWSCPCPNITMEEGPLLVMGDVQDGMAVIQPDSYVRPISDKRLKRIHEVLEKRT
CEMLQRFRD
Download sequence
Identical sequences XP_021423448.1.32639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]