SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_021455162.1.32639 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_021455162.1.32639
Domain Number 1 Region: 50-180
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.84e-48
Family Regulator of G-protein signaling, RGS 0.0000098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_021455162.1.32639
Sequence length 188
Comment regulator of G-protein signaling 21-like isoform X2 [Oncorhynchus mykiss]; AA=GCF_002163495.1; RF=representative genome; TAX=8022; STAX=8022; NAME=Oncorhynchus mykiss; AL=Chromosome; RT=Major
Sequence
MPSLIITETLIQTQHFNMEQDDRRRNKNLGKNFMCRLQCMFSHSPTSESRLSLEDTQQWS
QSLERLLESKYGLATFRTFLKSEFSDENIEFWLTCEEYKKIKSSFRMSSKAKKIYEHFIK
AEAPKEINIDYHTREQIKRAVKNPTLQCFDDAQKIVYGLMERDSYPRFLRSDIYRSLLDS
LAADAVKG
Download sequence
Identical sequences A0A060YNN9
XP_020348400.1.87700 XP_021455162.1.32639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]