SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_021460055.1.32639 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_021460055.1.32639
Domain Number 1 Region: 39-169
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.96e-47
Family Regulator of G-protein signaling, RGS 0.00000879
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_021460055.1.32639
Sequence length 174
Comment regulator of G-protein signaling 8-like [Oncorhynchus mykiss]; AA=GCF_002163495.1; RF=representative genome; TAX=8022; STAX=8022; NAME=Oncorhynchus mykiss; AL=Chromosome; RT=Major
Sequence
MKTRLACLSNKSDSYTDFTEFLPPAQDRTTRCLKLTKDEVIRWADSFDVLLSHKYGLAAF
RAFLKTEFSDENIEFWMACEEYKKIKTPAKLVTKANKIYNEFIDVKAPREVNIDFRTREV
TRQSLEEPTPSSLNEVQARVHSLMEKDSYPRFLRSKIYQDLLKTQYTHCQRNSV
Download sequence
Identical sequences A0A060WZJ9
XP_021460055.1.32639 XP_021460056.1.32639 XP_021460057.1.32639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]