SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_021471197.1.32639 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_021471197.1.32639
Domain Number 1 Region: 37-519
Classification Level Classification E-value
Superfamily Sema domain 5.49e-100
Family Sema domain 0.00074
Further Details:      
 
Domain Number 2 Region: 1387-1510,1676-1861
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.84e-34
Family p120GAP domain-like 0.026
Further Details:      
 
Domain Number 3 Region: 951-1023
Classification Level Classification E-value
Superfamily E set domains 0.00000000000306
Family Other IPT/TIG domains 0.039
Further Details:      
 
Domain Number 4 Region: 860-951
Classification Level Classification E-value
Superfamily E set domains 0.0000000000102
Family Other IPT/TIG domains 0.034
Further Details:      
 
Domain Number 5 Region: 1043-1125
Classification Level Classification E-value
Superfamily E set domains 0.000000000267
Family E-set domains of sugar-utilizing enzymes 0.046
Further Details:      
 
Domain Number 6 Region: 522-574
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000129
Family Plexin repeat 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_021471197.1.32639
Sequence length 1900
Comment plexin-D1-like [Oncorhynchus mykiss]; AA=GCF_002163495.1; RF=representative genome; TAX=8022; STAX=8022; NAME=Oncorhynchus mykiss; AL=Chromosome; RT=Major
Sequence
MPPSEKIVVLIFGVLVLESSWNAQHSPWLASALQIQQAFASPNQTNNFVVDEVSRKVYLA
TVNMVYQLNRTLSVEVEKRTGPVEDNLLCHAPQLPQAPCEHPKSLTDNFNKLLELDREQG
VLVVCGSVYQGFCELRKMENISQIAVEFPPQGEKTVFPSMLNIAANHPNASTVGLIFRSH
GGNTRLLVGATYTGVGTTFFPKNHSKEDLRFENTPEIAIRSLNINDLSRLFTYDINPSED
NVFKIKQEVKQKNKLNFVHAFIQKTYSYIAINNDANMGHKESQPNSILARICLDTENPRK
STSESRKLTESFIQMPLQCGYNGNIYNRLVSVHPAEIHSGTGEGLESYLFGVFTKSDRKS
ALCAFRFSDIEEEIRQGRRNCSNSPSSEVQVLDSVIQGSGAACVHKGNLVLQPEQLDCGA
AHLQHPLALQRPLRATPLFESLGLSSVAVDNVHHHTVVFLGTSTGRLRKLTLLKNLTVAN
QWSLKLPAGESVHHIMTFDPIDRNYLYLMTSHHLLRVKVAACSQYRTCSDCLGAGDAHCG
WCTLESRCSIQRECAWGPLARSWIGMGEGPQQCPSMTLTPPEISLSTDIKDVGILINGSV
PDLVGSRVECDYGLGVATAATVHLDYGPAQIQTCPLLPRERYPNIPPGRDHLTVPVAIKV
NGTSVVSGSFVIYDCERTGAIHTKTACISCLSTRWRCYWDQDSHSCLSSKEDSKHSLLEN
ATFCPSLVAENVAPSPSGMTQNFTLFLDNVVQGEELECDFGNEQRYDSRWLEDSSGVKCS
GVTLTTVEKSQVFQLSLRRKGHLDKYIDSPKPVTVEVYNCGVGNGDCSQCWGRENLGHLC
GWCDNSCRPRNDCQYMNSQCPDPEITKISPQSGPLEGGTLLTVQGRNMGRRAEVVEVSIG
MFPCTIIPDQYTVSVELVCVTGQAIDPTKNFVRITVNQKAMAVSKEAFSYLVPKLLSMEP
RKGSRSGGTRVTIKGEHLDTGSQIRVKVNGTQECTILTLTEDTIECTMPAALHTHTEAVS
VCVEFEYIPCQRSELLTQYIYEKNPSISYIKPRQSYLSGGRTITVTGQGFDLVQSVTMEV
LDIGQAACKVQPPSMITCSSPTSSQSQQATVEFFLNGVLYTGDSPIFYGPGQEEEEEPHG
GHFLLEYVEDPQFFTANKEKLIKHHPGEPLTLIINKGPSNLELAPEEYSVMIGSYPCDIS
FHNDQLFHCSINGSLGSSEGELPVTVQVGNFQRIIAKVQLGGSELAIVVSIVVCCVLLLL
CTVALVVYCTKSRRAERYWQKTLLQMEEMESQIREEIRKGFAELQTDMTDLTKELNSSQG
IPFLEYKQFVTRTFFPKMCSDYERSLVQPVYENNALGPRALPETHPLLQDWQPSNTAKPN
MEEGITLFSTLLNNKHFLVTFVHALEQQKDFAVRDRCSLASLLTIALHGKLEYYTSIMKD
LLVDLIDASAAKNPKLMLRRTESVVEKMLTNWMSICMYSYLKETVGEPFFLLLCAIKQQI
NKGSIDAITGKARYTLNEEWLLRENIEAKPQNINVSFQGCGMDSLAVRVMNTDTICQVKD
KILDAFYKNLPFSQWPQAEDVDLEWFASGSNSRILQDLDNTSVMEDGRKKLNTVTHYQIP
EGASFAMSMKDKRDNTLGRAKDLDTEKYVHLVLPHDELFENKKSHRQSHRKKVLPEIYLT
RLLSTKGTLQKFLDDLFQAILSIPAERPPLAIKYFFDFLEEQADKRGITDPDTLHIWKTN
SLPLRFWVNILKNPQFVFDIDKTDHMDACLSVIAQAFIDACSISDLQLGKDSPTNKLLYA
KEIPEYKKRVQCYYKQIQEMAPLSEQEMNAHLAEESRKYRNEFNTNLALTEIYKYAKKYR
NQVVSALESNPTAKRTQLHHKFEQVIALVEDNIYECSSEA
Download sequence
Identical sequences XP_021471197.1.32639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]