SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_021484513.1.76796 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_021484513.1.76796
Domain Number 1 Region: 365-422
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.04e-25
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 2 Region: 169-226
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.33e-24
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 505-562
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.64e-24
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 4 Region: 281-338
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.72e-24
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 5 Region: 225-282
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.4e-23
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 6 Region: 449-506
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.56e-23
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 7 Region: 31-88
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.27e-21
Family KRAB domain (Kruppel-associated box) 0.00013
Further Details:      
 
Domain Number 8 Region: 93-142
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.23e-20
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 9 Region: 547-599
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.65e-20
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 10 Region: 328-360
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000653
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 11 Region: 412-444
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000271
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 12 Region: 132-164
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000313
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_021484513.1.76796
Sequence length 605
Comment zinc finger protein 431-like isoform X5 [Meriones unguiculatus]; AA=GCF_002204375.1; RF=representative genome; TAX=10047; STAX=10047; NAME=Meriones unguiculatus; strain=243; AL=Scaffold; RT=Major
Sequence
MNILTVCMIMYIMCTSLQSEDGLRTPELGLMDSLTYDDVHVNFTQEEWVLLDPSQKSLYK
EVMLETYRNLTAIGYNWEDHNIEEHCQSSRRHGRHGRIHTGEKPYECNQCGKTFACHSGL
QYHKRTHTGEKPYECNQCGKTFACHSGLKYHKITHTGEKPYECTQCGKAFAHHSLLQIHK
RTHTGEKPYECNECGKAFAHHSYLQIHKRTHTGEKPYECNQCGKAFASHSNLQYHKITHT
GEKPYKCNQCGKAFAHHSLLQIHKRIHTGEKPYECNQCTKAFTSHSHLQIHKKTHTGEKP
YECNQCGKAFACHSGLKYHKRTHTGEKPYECNQCGKAFAGYNLLQIHKRTHTGEKPYECN
QCGKAFASHSYLQRHERIHTGEKPYECTQCGKAFASHSYLRIHKRTHTGEKPYECNQCGK
AFAYHNLFQVHKITHTGEKPYECNQCGTAFAHYSHLQIHKRTHTGEKPYGCNQCGKTFAS
HNGLKYHKRTHTGEKPYKCNQCGKAFTSQNLLQIHNRTHTGEKPYECNQCGKAFAHHSHL
QIHKRTHTGEKPYECNQCGKTFAQNSHLQTHKRTHTREKPYACNQCGKAFSCPKSLQYHK
RIHPG
Download sequence
Identical sequences XP_021484513.1.76796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]