SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_021484519.1.76796 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_021484519.1.76796
Domain Number 1 Region: 419-476
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-24
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 2 Region: 307-364
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.6e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 3 Region: 111-168
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.6e-24
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 4 Region: 167-224
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.08e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 5 Region: 363-420
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.62e-22
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 6 Region: 531-588
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.96e-22
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 7 Region: 475-532
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6e-22
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 8 Region: 2-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.01e-21
Family KRAB domain (Kruppel-associated box) 0.00016
Further Details:      
 
Domain Number 9 Region: 209-261
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.37e-19
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 10 Region: 573-625
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.29e-17
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 11 Region: 63-112
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.6e-16
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 12 Region: 251-308
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000117
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_021484519.1.76796
Sequence length 638
Comment zinc finger protein 431-like isoform X1 [Meriones unguiculatus]; AA=GCF_002204375.1; RF=representative genome; TAX=10047; STAX=10047; NAME=Meriones unguiculatus; strain=243; AL=Scaffold; RT=Major
Sequence
MDSLTYDDVHVNFTQEEWALLDPSQKSLYKDVMLETYRNLSAIGYSWEDHNIEEHSQSSR
RHGRHERSHTGEKPYEVIQYGEDFTHHSGLQMHKRKHTGEKPYKCNQCDKAFSQHSHLRI
HKRTHTGEKPYKCNQCGKTFAYHGYLQIHKRMHTGEKPYKCNQCDKAFSQHSHLRIHKRT
HTGEKPYECKHCGKAFACLSHLQRHERIHAGEKPYECNQCAKTFSQHSSLQIHKRTHTGE
KPYECRHCGKAFAYRGQLHIHKRTHTEEKPHEHIQYGEALTHYSILQIHNRTHSGEKLYE
CNQCGKVFACHSHLQIHKRTHTGEKPYKCDQCDKAFSQHSYLQIHNRTHTGEKPYECNQC
GKTFAYHGYLQVHRRTHTGEKPYECIQCGKAFACHSSLRIHKRTHTGEKPYKCDQCSKAF
AFLSSLRQHKRTHTGEKPYKCNQCDKAFSQHSYLRIHEKTHTGEKPYKCNQCGKTFAHHG
QLQRHERFHIGEKPYKCNHCDKAFLQHSCLQIHKRTHTGEKPYECNQCGKAFAYHDYLQI
HKRTHTGEKPYECIQCGKAFAYHGYLQVHKRTHTGEKPYKCNQCDKAFSHHKSLQIHKRI
HNGEKPYEYNQCSKAFVCHSDIQRHVRNHTGKKHYECI
Download sequence
Identical sequences XP_021484519.1.76796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]