SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_021496683.1.76796 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_021496683.1.76796
Domain Number 1 Region: 52-548
Classification Level Classification E-value
Superfamily Sema domain 5.23e-100
Family Sema domain 0.0015
Further Details:      
 
Domain Number 2 Region: 1411-1535,1701-1857
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.28e-33
Family p120GAP domain-like 0.024
Further Details:      
 
Domain Number 3 Region: 980-1070
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000899
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.076
Further Details:      
 
Domain Number 4 Region: 890-981
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000315
Family Other IPT/TIG domains 0.015
Further Details:      
 
Domain Number 5 Region: 1068-1148
Classification Level Classification E-value
Superfamily E set domains 0.0000000000455
Family E-set domains of sugar-utilizing enzymes 0.052
Further Details:      
 
Domain Number 6 Region: 551-602
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000051
Family Plexin repeat 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_021496683.1.76796
Sequence length 1925
Comment plexin-D1 [Meriones unguiculatus]; AA=GCF_002204375.1; RF=representative genome; TAX=10047; STAX=10047; NAME=Meriones unguiculatus; strain=243; AL=Scaffold; RT=Major
Sequence
MARRAAGGAPPSARAAAAVPLPPRPHSRGPGLPPLPLLLLLGAARAGALEIQRRFPSPTP
TNNFALDGAAGTVYLAAVNRLYQLSSANLSLEAEATVGPVPDSPLCHAPQLPQASCEHPR
RLTDNYNKILQLDPGQGLVVACGSIYQGLCQLRRRGNISALAVSFPPAAPPAEPVTVFPS
MLNVAANHPNASTVGLVLPPASGTGGSRLLVGATYTGYGSSFFPRNRSLEDHRFENTPEI
SIRSLDARGDLAKLFTFDLNPSDDNILKIKQGAKEQHKLGFVRAFLHPAAPGRGARPYAY
LALTSEARAGDKDSQARSLLARICLPRGAGGDAKKLTESYIQLGLQCAGGPGRGDLYSRL
VSVFPARDLFFAVFERPQGTPGARNSPAALCAFRFADVQAAIRAARTACFVEPAPDVVAV
LDSVVQGTGPACESKRNIQLQPEQLDCGAAHLQHPLSILQPLRASPVFRAPGLTAVAVAS
ANNYTAVFLGTATGRLLKISLNESMQVVSRRVLTVAYGEPVHHVMQFDPTDPGYLYLMTS
HQMARVKVAACEMHSSCSDCVGAADAYCGWCTLETRCTLQQDCANSSQPHFWTSASEGPG
RCPTMTVLPSEIDVRRDYTGMILQISGSLPSLSGMEMACDYGNGVQTVARVPGPAYDHQI
AYCNLLPRAQFPSFPAGQDHVTVEMSVRVKGHNIVSANFTIYDCSRIGQVYPHTACTSCL
STQWPCFWCTQQHSCVSNRSRCEGSLNPTSPQDCPQILPSPLLPVPTGGSQDILVPLTRA
TFFHGASLECSFGLEESFEAVWVNDSLIRCNQVVLHTAQKSQTFPLSLKLKGPPDRFLDS
PNPMTVGVYNCAMGSPDCSQCLGREDLGHLCVWNDGCRLRGPLQPLPGACPAPEIRSIEP
LSGPLDGGTLLTIRGRNLGRRLSDVAHGVWIGSVACEPLAERYTVSEEIVCATGAAPGAF
SDVVTVNASKEGASREHFSYVLPVVHSLEPSMGPKAGGTRITIHGSDLHVGSMLQVLVND
TDPCTELTRTATSITCTVPGGALPAPVPVCVRFEGRGCVHGNLSFWYMRNPVITAIRPGR
SPVSGGRTITVAGERFHMVQNFSMAVHHIGREPTFCKVLNSTLITCPSPGALSNASAPVD
FFINGRAYADEAAEELLDPAEAQRGSRFRMDYLPNPQFSTAKREKWIKHHPGEPLTLVIH
KEQDSLGLESHEYHIKIGQVSCDIQIVSDRVIHCSVNESLGTAEGQLPITIQVGNFNQTI
ATLQLGGSETAIVVSIVICSVLLLLSVVALFVFCTKSRRAERYWQKTLLQMEEMESQIRE
EIRKGFAELQTDMTDLTKELNRSQGIPFLEYKHFVTRTFFPKCSSLYEERYVLPSQTLNS
QGSSPPQETHPLLGEWNIPEHCRPSMEEGISLFSSLLNNKHFLIIFVHALEQQKDFAVRD
RCSLASLLTIALHGKLEYYTSIMKELLVDLIDASAAKNPKLMLRRTESVVEKMLTNWMSI
CMYGCLRETVGEPFFLLLCAIKQQINKGSIDAITGKARYTLNEEWLLRENIEAKPRNLNV
SFQGCGMDSLSVRAMDTDTLTQVKEKILEAFCKNVPYSQWPRAEDVDLEWFASSTQSYVL
RDLDDTSVVEDGRKKLNTLAHYKIPEGASLAMSLTDKKDTTLGRVKDLDTEKYFHLVLPT
DELAEPKKSHRQSHRKKVLPEIYLTRLLSTKGTLQKFLDDLFKAILSIREDKPPLAVKYF
FDFLEEQAEKRGISDPDTLHIWKTNSLPLRFWVNILKNPQFVFDIEKTDHIDACLSVIAQ
AFIDACSISDLQLGKDSPTNKLLYAKEIPEYRKIVQRYYKQIQDMTPLSEQEMNAHLAEE
SRKYQNEFNTNVAMAEIYKYAKRYRPQIMAALEANPTARRTQLQHKFEQVVALMENNIYE
CYSEA
Download sequence
Identical sequences XP_021496683.1.76796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]