SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_021497602.1.76796 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_021497602.1.76796
Domain Number 1 Region: 64-177
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.06e-28
Family Spermadhesin, CUB domain 0.00054
Further Details:      
 
Domain Number 2 Region: 272-389
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000288
Family Spermadhesin, CUB domain 0.0036
Further Details:      
 
Domain Number 3 Region: 476-513
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000484
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 4 Region: 185-222
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000275
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 231-270
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000117
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 437-475
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000196
Family LDL receptor-like module 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_021497602.1.76796
Sequence length 792
Comment low-density lipoprotein receptor-related protein 3 isoform X1 [Meriones unguiculatus]; AA=GCF_002204375.1; RF=representative genome; TAX=10047; STAX=10047; NAME=Meriones unguiculatus; strain=243; AL=Scaffold; RT=Major
Sequence
MEKRAAAGPEGAPGARAPLAVVCLVNLFLTGRLSSAVPALGKAGTTWGFRFQPATHPPET
QAACSGKLEQHTERRGVIYSPAWPLNYPPGTNCSWYIQGDRGDMITISFRNFDVEESHQC
SLDWLLLGPAAPPRQEAFRLCGSAIPPAFISARDHVWIFFHSDASSSGQAQGFRLSYIRG
KLGQASCQTDEFRCDNGKCLPGPWQCNMVDECGDGSDEGNCSAPASEPPGSLCPGGTFPC
SGARSTRCLPVERRCDGTQDCGDGSDEAGCPDLACGRRLGSFYGSFASPDLFGAARGPSD
LHCTWLVDTQDPRRVLLQLELRLGYDDYVQVYEGLGERGDRLLQTLSYRSNHRPVSLEAA
QGRLTVAYHARARSAGHGFNATYQVKGYCLPWEQPCGGSGSEGDDGGAGEQGCFSEPQRC
DGWWHCASGRDEQGCPACPPDQYPCEGGSGLCYAAADRCNNQKSCPDGADEKNCFSCQPG
TFHCGTNLCIFETWRCDGQEDCQDGSDEHGCLAAVPRKVITAALIGSLVCGLLLVIALGC
AFKLYSLRTQEYRAFETQMTRLEAEFVRREAPPSYGQLIAQGLIPPVEDFPVYSASQASV
LQNLRTAMRRQMRRHASRRGPSRRRLGRLWNRLFHRPRAPRGQIPLLTAARTSQTVLGDG
LLQAAPGVVPDPPGPHTDAGSPREARAGPPSAPGHAPEVGPSVPAPPLNLRDPEYRPEGK
ERKACEDPQEDSPAPVDTPPEPCLAQDPYPQTPTASGTQDPQLPEPLRVCRSPPPTCSPV
LEASDDEALLVC
Download sequence
Identical sequences XP_021497602.1.76796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]