SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_021512071.1.76796 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_021512071.1.76796
Domain Number 1 Region: 67-491
Classification Level Classification E-value
Superfamily Sema domain 4.71e-102
Family Sema domain 0.00018
Further Details:      
 
Domain Number 2 Region: 1428-1553,1751-1903
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.75e-40
Family p120GAP domain-like 0.054
Further Details:      
 
Domain Number 3 Region: 945-1034
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000382
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.07
Further Details:      
 
Domain Number 4 Region: 853-948
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000496
Family Other IPT/TIG domains 0.032
Further Details:      
 
Domain Number 5 Region: 496-548
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000068
Family Plexin repeat 0.0021
Further Details:      
 
Domain Number 6 Region: 1033-1077,1115-1168
Classification Level Classification E-value
Superfamily E set domains 0.00000012
Family Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_021512071.1.76796
Sequence length 1970
Comment plexin-B3 isoform X1 [Meriones unguiculatus]; AA=GCF_002204375.1; RF=representative genome; TAX=10047; STAX=10047; NAME=Meriones unguiculatus; strain=243; AL=Scaffold; RT=Major
Sequence
MFLSQFRSHSLPCPLVPVGEWSIFSIFPSGLMLTDCLQAPVMAPWSPVSLHLLLLFPLLL
PLTRAHRFSVPNASFNHLVLAPGQGTLYVGAVNHLFQLSPELKMESMAVTGPVIDSPDCV
PFRDLAECPQAQLTDNANQLLLVSSRAQELVACGQVRQGVCEKRHLDNVAQVLYQAEDPG
DGQFVAANTPGVATVGLVVPLPGQDFLLVARGLAGKLSAGVPPLTVRQLSGPQPFSSEGL
GRLVVGDFSDYNNSYVGAFSDAHSAYFVFRRRGARAQAEYRSYVARVCLGDVNLYSYVEV
PLACHGQGLIQAAFLLAPDTLLGAFAAGTSQAQAALCAFPLADLNRSMEQARRLCYTTGG
QGPNGMEEATVEYGVTSRCITLPPDSPESYPCGDEHTPSPIAGRQPLEAQPLLQLEQPIS
AVAALQADGHTIAFLGDTQGQLHKVFLNGSQGQVYHSQQVGPPGSAISPDLLVDSNGDHL
YVLTSQQVDRILVAACPQFPNCTTCLQARDPLCGWCILQGRCTRRGKCGRAAQPNQWLWS
YEDNDCLHIQSLLPAQHPRQEQGQVTLSVPQLPTLAMDEYFHCAFGDYKSLGHVEGPHVL
CVTPPHDQVPPNPPGSDHVTLPLALMFEDVVVAATTFSFYDCSAVQALEVAAPCRTCVSS
RWRCRWCPQGSHCVYGEHCPEGEKTVHGAQEVGIQVREPGACPQVEGLASPQLVHVGWES
HVALHIQNLHYFQGLPAFYYCWLELSGKLQKLPASLEETSRDSGLIHCQAQQFHPSMSQW
ELPVPIYVTRGESQRLDNAGDLHVTLYDCAMGHPDCSHCQAANESLSCLWCGDGQPACRY
GPLCPPGAVEQLCPTPSIDVIEPLTGPPEGGLAITILGSNLGQTFNDVRIAVTVAGRICH
PDPSLYRISTRIVCVTSPAPNGTAGPVQVAIKSRPPGISTQHFTYQDPVLLDLNPQWGPQ
AGGTKLTIRGQYLQTGGNVSAFVGDQPCPIQEPVCPEAIICHTMPQAEPGEAVVLVVFGH
VERKLFNTPFRYTANPQLIAAEPSVSFRGGGRVIRVRGTGLDVVWQPLLSVWLEDEAQVK
ALGVQAQDVNPRRSCGVPAANPQTCIQLEGGLLQCSTLCSVNSSSLLLCHSPAVPDGALP
KRVFFSLDNMQVDFASASGGQGFLYQPNPRLVPLSHEGITHPHRLKPGHVLDVEVSVPLS
RHCPCTHHPEEEGVGSGDGPTGSGSCYVSQGEGLNLGITKEEVQVHIGDGECLVKTLTLT
HLYCEPPSQAPQPTNGSGTLPQLVVQMGNVRLTLGPVQYEAEPMMSMVPVEAQVGLGLGA
AMLIAAVLLLTLTYRHKSKQALRDYQKVLVQLENLETGVGDQCRKEFTDLMTEMTDLTSD
LEASGIPFLDYRTYAERAFFPGHGGCPLQPGLEGPGEEGRHATMRQGFTQLSNLLNSKLF
LLTLIHTLEEQPSFSQRDRCHVASLLSLALHSKLEYLTDIMRTLLGDLAAHYVHKNPKLM
LRRTETMVEKLLTNWLSICLYAFLKEVAGEPLYMLFRAIKYQVDKGPVDAVTGKAKRTLN
DSHLLREDVEFRPLTLMALVEPGAAGAAGNSNVHQVPARVLDTDTITQVKEKVLDQVYKG
TPFSQRPSVYSLDLEWRSGLAGHLTLSDEDLTSVTQNQWKRLNTLQHYKVPDGATVVLIP
QLHNGGTVSQSLGQTGCPSGENTPMLEDSEEGGVRLWHLVKATEEPEGGKVRRSSLRERE
RERARAKAIPEIYLTRLLSMKGTLQKFVDDTFQAILSVNHPVPIAVKYLFDFLDELAEKH
GIEDPETLHIWKTNSLLLRFWVNALKNPQLIFDVRVSDNENAILAVIAQTFIDSCMVSEH
KVGRDSPVNKLLYAREIPRYKQMVEKYYADIRQSSPASYQEMNSALAELSGNYTSAPHCL
EALRELYNHIHRYYDQIISALEEDPVAQKMQLACRLQQIAALVENKVTDL
Download sequence
Identical sequences XP_021512071.1.76796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]