SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_021516271.1.76796 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_021516271.1.76796
Domain Number 1 Region: 173-230
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.5e-24
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 398-455
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.4e-24
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 3 Region: 454-511
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.46e-23
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 
Domain Number 4 Region: 511-567
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.87e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 5 Region: 118-174
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.74e-23
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 6 Region: 315-371
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.16e-22
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 7 Region: 259-315
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.07e-20
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 8 Region: 554-614
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.41e-19
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 9 Region: 2-60
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.09e-18
Family KRAB domain (Kruppel-associated box) 0.0019
Further Details:      
 
Domain Number 10 Region: 79-131
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000193
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 11 Region: 361-393
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000812
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 12 Region: 603-639
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000265
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_021516271.1.76796
Sequence length 652
Comment zinc finger protein 420-like [Meriones unguiculatus]; AA=GCF_002204375.1; RF=representative genome; TAX=10047; STAX=10047; NAME=Meriones unguiculatus; strain=243; AL=Scaffold; RT=Major
Sequence
MEELLSFIDVAIDFSADECECLDSAQWNLYKEVMLENYSNLVFLGLALSKPYLVTFLEQS
TEPWSVKNEAVSAIHSGSKTYQCKDRGKVFDRNSVLIQHKRIHTGERLCACEESGKPFNY
SSSFKQHQRIHTGEKPYKCKECGKAFNCSSSLNQHQQIHRGEKLYKCDDCGQAFSCSSYL
YKHRRIHTGMKPYKCKECGKAFYCSVNLIYHQRTHTGEKPYECDECGKAFSICLTFMKHQ
QIHRGENPPYKRKECKKIFNNCYNLIQHQNIHPGVKPYTCKECGKSFNYSSRLKQHQSIH
TREKPYKCEVCSKDFKCSSYLGKHQKIHTEEKPYKCEVCGKTFKCSSYLGKHQRVHSGEK
PYRCEECGKPFSIFSTFMKHQQTHSREKPYKCKECEKAFSNFYNLIQHQKIHTGEKPHAC
EECGKSFNYSSRLKQHQSIHTREKPYKCEVCGKAFKCSSYLSKHHRIHTGEKPYKCEECG
KAFKCSSYLVKHQRVHTGEKRYRCEECGKPFTNCSGLIVHRRVHTGEKPYKCEKCGKAFS
VFTTLSRHQRIHFGEKPYNCDECGKTFNIHSMLSKHQRIHTRKKPYKCKDCGKAFNYTSS
LAQHEEFHTGEKPYKCEQCVKAFQNCSNFTQNCRIHCREKSRLFQTLLQTLP
Download sequence
Identical sequences XP_021516271.1.76796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]