SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_021517314.1.76796 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_021517314.1.76796
Domain Number 1 Region: 35-125
Classification Level Classification E-value
Superfamily PDZ domain-like 2.26e-25
Family PDZ domain 0.0000231
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_021517314.1.76796
Sequence length 140
Comment PDZ domain-containing protein 11 [Meriones unguiculatus]; AA=GCF_002204375.1; RF=representative genome; TAX=10047; STAX=10047; NAME=Meriones unguiculatus; strain=243; AL=Scaffold; RT=Major
Sequence
MDSRIPYDDYPVVFLPAYENPPAWIPPHERVYHPDYNNELTQFLPRIVTLKKPPGAQLGF
NIRGGKASQLGIFISKVIPDSDAHRAGLQEGDQVLAVNDVDFQDIEHSKAVEILKTAREI
SMRVRFFPYNYHRQKERTVH
Download sequence
Identical sequences A0A091DH97 A0A0N8ETC2 A0A1U7TTL6 A0A212BZ97 A0A2I2U069 A0A2K6G5F1 D2H899 G1PHA5 I3N6Q0 J9NRG7 M3XYN5 Q32LE7 Q6QA76 S7QAJ4 S9XQG1 U6CQV5 W5Q220
ENSCAFP00000036090 ENSAMEP00000009668 ENSMPUP00000004186 ENSMLUP00000010048 ENSSTOP00000020046 ENSVPAP00000007985 ENSTBEP00000002388 NP_001001630.1.46622 NP_001032692.1.59421 NP_001032692.1.76553 XP_002918059.1.58354 XP_004000642.1.62641 XP_004022205.1.66739 XP_004396677.1.74151 XP_004595279.1.84141 XP_004648082.1.9945 XP_004661038.1.11716 XP_004777248.2.14098 XP_004777249.2.14098 XP_004777250.1.14098 XP_004872665.1.39548 XP_005228068.1.76553 XP_005340043.1.77405 XP_005401675.1.28644 XP_005401676.1.28644 XP_005401677.1.28644 XP_005700760.1.57651 XP_005882910.1.60319 XP_006074258.1.26621 XP_006074259.1.26621 XP_006074260.1.26621 XP_006082969.1.53796 XP_006146203.1.99106 XP_006146204.1.99106 XP_006146205.1.99106 XP_006146206.1.99106 XP_006193967.1.101512 XP_006217736.1.17985 XP_006748618.1.47382 XP_006748619.1.47382 XP_008057000.1.4292 XP_008057001.1.4292 XP_008578561.1.73410 XP_008578562.1.73410 XP_008842609.1.79516 XP_008842610.1.79516 XP_010630466.1.5607 XP_010630467.1.5607 XP_010630468.1.5607 XP_011369745.1.92234 XP_011997616.1.54773 XP_012416560.1.74151 XP_012499090.1.63892 XP_012499097.1.63892 XP_012499104.1.63892 XP_012499113.1.63892 XP_012591690.1.48125 XP_012591691.1.48125 XP_012785273.1.84141 XP_012903702.1.14098 XP_012923897.1.39548 XP_013220491.1.77405 XP_013220492.1.77405 XP_013846370.1.46622 XP_014422479.1.101512 XP_014422480.1.101512 XP_014422481.1.101512 XP_014442400.1.99106 XP_014936062.1.86478 XP_015106190.1.17985 XP_015106191.1.17985 XP_015106192.1.17985 XP_015106193.1.17985 XP_015106194.1.17985 XP_015357130.1.40921 XP_015357131.1.40921 XP_015357132.1.40921 XP_015988116.1.101085 XP_016062874.1.3490 XP_017536577.1.32401 XP_019284182.1.44245 XP_019603457.1.88060 XP_019603458.1.88060 XP_019603459.1.88060 XP_019603460.1.88060 XP_019811884.1.53367 XP_019811885.1.53367 XP_020738584.1.74333 XP_021517313.1.76796 XP_021517314.1.76796 XP_021517315.1.76796 XP_021517316.1.76796 XP_021535989.1.83697 XP_021535999.1.83697 XP_021536008.1.83697 XP_549060.2.84170 ENSTSYP00000000710 ENSSTOP00000020046 ENSFCAP00000008003 ENSSSCP00000013173 ENSBTAP00000017091 ENSTBEP00000002388 ENSTSYP00000000710 ENSCAFP00000036090 ENSSSCP00000013173 ENSSSCP00000030771 ENSMLUP00000010048 9615.ENSCAFP00000024708 9685.ENSFCAP00000008003 9823.ENSSSCP00000013173 ENSMPUP00000004186 ENSVPAP00000007985 ENSAMEP00000009668 ENSBTAP00000017091 ENSOARP00000016758 ENSFCAP00000008003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]