SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_021527295.1.9421 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_021527295.1.9421
Domain Number 1 Region: 2219-2312
Classification Level Classification E-value
Superfamily C-type lectin-like 3.61e-33
Family Link domain 0.00011
Further Details:      
 
Domain Number 2 Region: 517-655
Classification Level Classification E-value
Superfamily FAS1 domain 1.18e-29
Family FAS1 domain 0.0019
Further Details:      
 
Domain Number 3 Region: 1481-1529,1607-1723
Classification Level Classification E-value
Superfamily FAS1 domain 1.22e-24
Family FAS1 domain 0.0039
Further Details:      
 
Domain Number 4 Region: 1725-1878
Classification Level Classification E-value
Superfamily FAS1 domain 5.89e-24
Family FAS1 domain 0.0046
Further Details:      
 
Domain Number 5 Region: 973-1130
Classification Level Classification E-value
Superfamily FAS1 domain 2.35e-22
Family FAS1 domain 0.0078
Further Details:      
 
Domain Number 6 Region: 393-507
Classification Level Classification E-value
Superfamily FAS1 domain 8.11e-20
Family FAS1 domain 0.0062
Further Details:      
 
Domain Number 7 Region: 2310-2473
Classification Level Classification E-value
Superfamily FAS1 domain 2.09e-16
Family FAS1 domain 0.01
Further Details:      
 
Domain Number 8 Region: 1148-1239
Classification Level Classification E-value
Superfamily FAS1 domain 0.00000000562
Family FAS1 domain 0.0096
Further Details:      
 
Domain Number 9 Region: 1553-1590
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000102
Family Merozoite surface protein 1 (MSP-1) 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_021527295.1.9421
Sequence length 2578
Comment stabilin-1 isoform X4 [Aotus nancymaae]; AA=GCF_000952055.2; RF=representative genome; TAX=37293; STAX=37293; NAME=Aotus nancymaae; AL=Scaffold; RT=Major
Sequence
MGSGGWRGMRPGRNEDRVGAGCGVQAPDHIPTVAQGPSKRCDVKTTLATHVPCTSCAAVK
KQTCPPGWLRELPDQIAQDCRYEVQLGGSMVSMSGCRRKCWKYIVEKACCPGYWGSQCYE
CPGGAETPCNGHGICLDGINRNGTCVCQENFHGSACQECQDPNRFGPDCQSVCSCVHGVC
NHGPRGDGSCRCFAGYTGPHCDQELPICQELRCPQNTQCSAEAPSCRCLPGYTQQGSECQ
APNPCWPSPCSPLAQCSVSSTGQARCHCPENYHGDGMVCLPKDPCTDNFAGCPSNSTLCV
YQKPGQASCICRSGLVSINSNASGGCQAFCSPYSCDRSATCQVTADGKTSCVCKQGEVGD
GRACYGHLLHEVQKAMQTGRVFLQLRVAMAMMDQGCREILTTAGPFTVLVPSVLSSSSRT
MNASLAQQLCRQHIIAGQHILEDTKTQQTRRWWTLAGQEITVVFNQFTKYSYKYKDQPQQ
TFNIYKPNNVAANGIFHVVTALRWQPPSGISGDPKRTISQILASTEAFSRFETILENCEL
PSILDGPGPFTVFAPSNKAVDSLRDGRLIYLFTTGLSKLQELVRYHVYNHGQLTVEKLIS
KGRILTMANQVLVVNISEEGRILLGPEGVPLQRVDLLASNGVIHMLDGILLPPTILPILP
KHCSEEQHKIVVGSCVDCHALNTSTCPLNSVKLDILPKECVYIHDPTGLNVLKKGCASYC
NQTIMKQGCCKGFFGPDCTQCPGGFSSPCYGKGNCSDGIQGNGACLCFPDYKGIACHICS
NPNKHGDQCQEDCGCVHGLCDNRPGSRGVCQQGTCAPGFSGHFCNETVRYCGPIEMAVHC
HLHAHCVSQGGFARCRCLDGFEGNGFSCTPSNPCSHPDRGGCSENAECVPGARGTHNCTC
HKGWSGDGHVCVAIDECELDTRGGCHADALCSYVGPGQSRCTCKTGFAGDGYQCSPIDPC
RAGNGGCHSLATCQAVGGGQRVCTCPPGFGGDGLSCYGDIFQELEANAHFSVFYQWFKNA
SITLPADHQVTALVPSEAAVHRLSPKDQAFWLQPRMLPNLVRAHFLQGAFFEKELARLSG
QEAATLDPSTHWEIRNISGRVWVQNASVDVADLLATNGVLHIISQVLLPPRGDVPGVQGL
LQQLDLVPAFSLFRDLLQHHRLVPQIEAATAYTIFVPTNHSLEAQGNSSHLDADTVRHHV
ILGEALSMEALGKGGHRNSLLGPAHWIVFYNHSGQPEVNHVPLEGPMLEAPGRSLIGLSG
VLRVGSSRCLHSHAEALREKCVNCTRKFRCTQGYQLQDTPRKSCVYRSGFSFARGCSYTC
AKKIQVPDCCPGFFGTLCEPCPGGLGGVCSGHGQCQDRFLGSGECRCHEGFHGTACEMCE
LGRYGPNCTGVCDCAHGLCQEGLQGDGSCVCNVGWQGLRCDQKIAGPQCPRKCDPNANCV
QDSAGAPTCACAAGYSGNGTFCSEVDPCAHGHGGCSPHANCTKVAPGQRTCTCQDGYTGD
GELCQEINSCLIHHGGCHIHAECIPTGPQQVSCSCLKGYSGDGIRTCDLLDPCSKNNGGC
SPYATCKSTGDGQRTCTCDTAHTVGDGLTCRTRLGLELQKDKHALFFASHLMEYKELKGD
GPFTIFVPDAYLMSNLLQDESRMARIRAHRLLVFRYHVIGCRRLRSEDLLEQGYATALSG
HPLRFSEREGSIYVNDFARVVSSDHEAVNGILHFIDRVLLPPEALHWEPGDAPVLRRNVT
AAAQSFGYKIVSSLLKMAGLLPLLRDPSHRPFTMLWPTDAALQALPLERQAWLYHEDHRD
KLAAILRGHIIRSVEGLASDLPNLGPLRTMHGTPISFSCSRMRPGELMVGEDDARIVQRH
LPFEGGLAYGIDQLLEPPGLGARCDRFETRSLKLNTCSICGMEPPCPQGSQDQGRTEGCW
HLSSKLWMSPSLRSLRLRSFWVQPSFWDRPEILGRGCHRNCVITTWKPSCCPGHYGSECQ
ACPGGPSSPCSDHGVCMDGMSGSGQCLCRSGFVGTACELCAPGAFGPHCQACRCTMHGHC
DEGLGGSGSCFCDEGWTGPRCEVQLELQPVCTPPCAPEAMCRAGNSCECSLGYEGDGHVC
TVADLCQDGHGGCSEHANCSQVGTVITCTCLPDYEGDGWSCRARNPCTDGHRGGCSEHAD
CLSTGLNTRRCECHAGYVGDGLQCLEESEPPVDRCLGQPPPCHSDAVCTDLHFQEKRAGV
FHLQATSGPYGLNFSEAEAACEAQGAVLASFPQLSAAQQLGFHLCLMGWLASGSAAHPVV
FPTADCGSGRVGIVSLGARKNLSERWDAYCFRVQDVACQCREGFVGDGISTCNGKLLDVL
AATANFSTFYGMLLGYANATQRGVDFLDFLEDELTYKTLFVPVNEGFVDNMTLSGPDLEL
HASNATFLSANASQGKLLLAHSGLSLIISDVGPDNSSWAPVAPGTVVVSHVIMWDIMAFN
GIIHALASPLLAPPQPVVLAPEAPPVAAGVGAVLAAGALLGLVAGALYLRTRGKPTGFGF
SAFQVDDADFSTWQEGTNPTLVSVPNPIFGSHDAFCEPFDDSLLEEDFPDTQRILTVK
Download sequence
Identical sequences XP_021527295.1.9421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]