SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_021531922.1.9421 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_021531922.1.9421
Domain Number 1 Region: 55-630,663-856
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.33e-292
Family Motor proteins 3.94e-16
Further Details:      
 
Domain Number 2 Region: 857-982
Classification Level Classification E-value
Superfamily Myosin rod fragments 9.59e-22
Family Myosin rod fragments 0.00033
Further Details:      
 
Domain Number 3 Region: 977-1093
Classification Level Classification E-value
Superfamily Myosin rod fragments 9.59e-21
Family Myosin rod fragments 0.001
Further Details:      
 
Domain Number 4 Region: 1263-1370
Classification Level Classification E-value
Superfamily Myosin rod fragments 1.02e-17
Family Myosin rod fragments 0.0028
Further Details:      
 
Domain Number 5 Region: 1535-1648
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000000174
Family Myosin rod fragments 0.0011
Further Details:      
 
Domain Number 6 Region: 1081-1172
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000000222
Family Myosin rod fragments 0.0037
Further Details:      
 
Domain Number 7 Region: 1369-1471
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000000314
Family Myosin rod fragments 0.01
Further Details:      
 
Domain Number 8 Region: 1781-1881
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000483
Family Regulator of G-protein signaling, RGS 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_021531922.1.9421
Sequence length 1981
Comment myosin-9 isoform X2 [Aotus nancymaae]; AA=GCF_000952055.2; RF=representative genome; TAX=37293; STAX=37293; NAME=Aotus nancymaae; AL=Scaffold; RT=Major
Sequence
MAQQAADKYLYVDKNFINNPLAQADWAAKKLVWVPSDKSGFEPASLKEEVGEEAIVELVE
NGKKVKVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKERYYSGLIYTYSGLFCVV
INPYKNLPIYSEEIVEMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTGESGAGK
TENTKKVIQYLAYVASSHKSKKDQGELERQLLQANPILEAFGNAKTVKNDNSSRFGKFIR
INFDVNGYIVGANIETYLLEKSRAIRQAKEERTFHIFYYLLSGAGEHLKTDLLLEPYNKY
RFLSNGHVTIPGQQDKDMFQETMEAMRIMGIPEEEQMGLLRVISGVLQLGNIVFKKERNT
DQASMPDNTAAQKVSHLLGINVTDFTRGILTPRIKVGRDYVQKAQTKEQADFAIEALAKA
TYERMFRWLVLRINKALDKTKRQGASFIGILDIAGFEIFDLNSFEQLCINYTNEKLQQLF
NHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIEKPAGPPGILALLDEECWFPKATDK
SFVEKVVQEQGTHPKFQKPKQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNIATLL
HQSSDKFVSELWKDEMQSTQRAYFYHRFPILHLEPVDRIIGLDQVAGMSETALPGAFKTR
KGMFRTVGQLYKEQLAKLMATLRNTNPNFVRCIIPNHEKKAGKLDPHLVLDQLRCNGVLE
GIRICRQGFPNRVVFQEFRQRYEILTPNSIPKGFMDGKQACVLMIKALELDSNLYRIGQS
KVFFRAGVLAHLEEERDLKITDVIIGFQACCRGYLARKAFAKRQQQLTAMKVLQRNCAAY
LKLRNWQWWRLFTKVKPLLQVSRQEEEMMAKEEELVKVREKQLAAENRLTEMETLQSQLM
AEKLQLQEQLQAETELCAEAEELRARLTAKKQELEEICHDLEARVEEEEERCQHLQAEKK
KMHQNIQELEEQLEEEESARQKLQLEKVTTEAKLKKLEEEQIIMEDQNCKLAKEKKLLED
RIAEFTTNLMEEEEKSKSLAKLKNKHEAMITDLEERLRREEKQRQELEKTRRKLEGDSTD
LSDQIAELQAQIAELKMQLAKKEEELQAALARVEEEAAQKNMALKKIRELESQISELQED
LESERASRNKAEKQKRDLGEELEALKTELEDTLDSTAAQQELRSKREQEVNILKKTLEEE
AKTHEAQIQEMRQKHSQAVEELAEQLEQTKRVKANLEKAKQTLENERGELANEVKVLLQG
KGDSEHKRKKVEAQLQELQVKFNEGERVRTELADKVTKLQVELDNVTGLLSQSDSKSSKL
TKDFSALESQLQDTQELLQEENRQKLSLSTKLKQVEDEKNSFREQLEEEEEAKHNLEKQI
ATLHAQVADMKKKMEDSVGCLETAEEVKRKLQKDLEGLSQRHEEKVAAYDKLEKTKTRLQ
QELDDLLVDLDHQRQTACNLEKKQKKFDQLLAEEKTISAKYAEERDRAEAEAREKETKAL
SLARALEEAMEQKAELERLNKQFRTEMEDLMSSKDDVGKSVHELEKSKRALEQQVEEMKT
QLEELEDELQATEDAKLRLEVNLQAMKAQFERDLQGRDEQSEEKKKQLVRQVREMEAELE
DERKQRSMAVAARKKLEMDLKDLEAHIDSANKNRDEAIKQLRKLQAQMKDCMRELDDTRA
SREEILAQAKENEKKLKSMEAEMIQLQEELAAAERAKRQAQQERDELADEIANSSGKGAL
ALEEKRRLEARIAQLEEELEEEQGNTELINDRLKKANLQIDQINTDLNLERSHAQKNENA
RQQLERQNKELKVKLQEMEGTVKSKYKASITALEAKIAQLEEQLDNETKERQAACKQVRR
TEKKLKDMLLQVDDERRNAEQYKDQADKASTRLKQLKRQLEEAEEEAQRANASRRKLQRE
LEDATETADAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDCSDEEVDGKADGAEAKPA
E
Download sequence
Identical sequences XP_021531922.1.9421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]