SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_021532347.1.9421 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_021532347.1.9421
Domain Number 1 Region: 430-487
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.51e-24
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 2 Region: 486-543
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.26e-24
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 3 Region: 178-235
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.39e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 4 Region: 542-599
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.03e-22
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 5 Region: 374-431
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-22
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 6 Region: 234-289
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-21
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 7 Region: 1-61
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.31e-21
Family KRAB domain (Kruppel-associated box) 0.00044
Further Details:      
 
Domain Number 8 Region: 293-347
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.35e-21
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 9 Region: 140-192
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.89e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 10 Region: 588-640
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.38e-17
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 
Domain Number 11 Region: 90-151
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000422
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 12 Region: 337-369
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000299
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_021532347.1.9421
Sequence length 643
Comment zinc finger protein 709 [Aotus nancymaae]; AA=GCF_000952055.2; RF=representative genome; TAX=37293; STAX=37293; NAME=Aotus nancymaae; AL=Scaffold; RT=Major
Sequence
MFQDSVVFEDVAVNFTQEEWALLGPSQKKLYRDVMQETFVNLASIGENWEDKNIEDHRNQ
GRKLRSHMVERLCERKEGNQLGEAISQTPNPKTNRKTFTRVKPYECSVCGKDYMCHSSLN
RHMRSHSEHRSYEYQKYGEKSYECKECGKRFSFRSSFRIHERTHTGEKPYKCKQCGKAFS
WPSSFQIHERTHTGEKPYECKECGKAFIYHTTFRGHMRMHTGEKPYKCKECGKTFSHPSS
FRNHERTHSGEKPYECKQCGKAFRYYQTFQIHERTHTGEKPYQCKQCGKALSCPTSFRSH
ERIHTGEKPYKCKKCGKAFSFPSSFRKHERIHTGEKPYDCKECGKAFISLPSYRRHMIMH
TGNGPYKCKECGKAFDCPSSFQIHERTHTGEKPYECKQCGKAFSCSSSFRMHERTHTGEK
PHECKQCGKAFSCSSSVRIHERTHTGEKPYECKQCGKAFSCSSSFRMHERIHTGEKPYEC
KQCGKAFSFSSSFRMHERTHTGEKPYECKQCGKAFSCSSSFRMHERTHTGEKPYECKQCG
KAFSCSSSIRIHERTHTGEKPYECKQCGKAFSCSSSVRMHERTHTGVKPYECKQCDKAFS
CSRSFRIHERTHTGEKPYACQQCGKAFKCSRSFRVHERVHTGE
Download sequence
Identical sequences XP_021532347.1.9421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]