SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_021535722.1.83697 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_021535722.1.83697
Domain Number 1 Region: 393-450
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.91e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 2 Region: 253-310
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.78e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 3 Region: 30-89
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.32e-24
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 4 Region: 477-534
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.9e-24
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 5 Region: 533-590
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.54e-23
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 6 Region: 309-366
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.98e-23
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 7 Region: 197-254
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.93e-23
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 8 Region: 155-207
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.9e-20
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 9 Region: 575-627
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.23e-20
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 10 Region: 117-170
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.77e-19
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 11 Region: 440-472
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000384
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 12 Region: 356-388
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000919
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_021535722.1.83697
Sequence length 636
Comment zinc finger protein 25-like [Neomonachus schauinslandi]; AA=GCF_002201575.1; RF=representative genome; TAX=29088; STAX=29088; NAME=Neomonachus schauinslandi; AL=Scaffold; RT=Major
Sequence
MNIVTCVPSQLLTFYQEQQKMNKSLKCAGQGSVSFKDVTVDFTQDEWLQLTGTQRTLYRD
VMLENYSHLVSVGCHLTKPDVIFRLEQGEELWPSEGEFPDQGDQGEKPSECDQVHVQSAL
TDQQRTWSEGKLYVCNECKKSFRHSSALKVHQRIHTGEKPYQCTECGKSFYAKSNFNHHQ
RTHTGEKPYECKECGKSFCVKSNLTKHQKTHTGKKPYDCNECGKTFCVKSNLTKHQKIHT
GLKPYECNECGKAFSMNSILIVHQRTHTGEKPYGCNECEKSFYKKSALTKHQKTHTGEKP
HECNECGKAFHMKSTLIIHQRTHTGEKPFKCNECEKSFYVKSLLNIHQRNHTGKKPHVCS
ECGKAFSMKSNLTDHQRTHSEEKPYECNECQKTFRHKSTLTVHQRTHTGEKPYKCNECGK
SFYMKSALSQHQRIHTGEKPFECKECEKTFFQKSHLTKHQRTHTGEKPYECKECKKTFFQ
KSHLIEHQRTHTGEKPHECNKCGKSFCYKSALTIHQRTHTEEKPYKCNECEKSFCMKSHL
TVHQRTHTGKNPFECKECGKTFYVKSNLINHQRTHTGEKPYECKRCGKSFCMKSTLTVHQ
RTHTGEKPYECNECGKSFCKKSTLTKHQVIHTREMP
Download sequence
Identical sequences XP_021535722.1.83697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]