SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_021538071.1.83697 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_021538071.1.83697
Domain Number 1 Region: 206-263
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.19e-24
Family Classic zinc finger, C2H2 0.0021
Further Details:      
 
Domain Number 2 Region: 458-515
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.82e-24
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 3 Region: 346-403
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.02e-24
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 4 Region: 34-94
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.75e-24
Family KRAB domain (Kruppel-associated box) 0.0018
Further Details:      
 
Domain Number 5 Region: 262-319
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.86e-24
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 6 Region: 402-459
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.8e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 7 Region: 514-569
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.84e-23
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 8 Region: 151-207
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.42e-22
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 9 Region: 617-669
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.26e-19
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 10 Region: 577-628
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000136
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 11 Region: 113-164
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000174
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 12 Region: 309-341
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000483
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_021538071.1.83697
Sequence length 683
Comment zinc finger protein 93-like isoform X1 [Neomonachus schauinslandi]; AA=GCF_002201575.1; RF=representative genome; TAX=29088; STAX=29088; NAME=Neomonachus schauinslandi; AL=Scaffold; RT=Major
Sequence
MHLHDVPLDGADLERGQRAPAPRAPQAAPAAVSVHQALLTFRDVAIEFSQEEWGCLNHTQ
RELYRDVMLENYGHLLFLGLIVSKPDLVIFLEQKKEPWDVKRKKTVAIHRGNHYECNKCG
EVFYQNSNLIIHKSMNMGENPYNKCECGKDFDWHSALPQHQGMHTGEKPYRCEECGKTFK
VCSSVNRHKRIHTGEKPYKCEECGKAFNQQSSLTEHHRIHNGEKPYKCEECGKAFIQRSH
LISHHRIHTGEKPYKCKECGKAFNHHSGLTQHHRIHTGEKPYKCKECGKAFNHDSSLTQH
HRIHTGEKPYKCKECGKAFNQRSHLISHHRIHIREKPYKCKECGKAFSQHSHLIRHHRIH
TGEKPYKCEECGKAFNRHSYLTQHHIIHTGEKPYQCKECGKAFNQHSSLIHHNRIHTGEK
PYKCKECGKAFKHDSTLTQHHRIHTGEKPYQCKECGKAFIQHSQLISHNRIHTGEKPYKC
KECGKAFNHNSSLTYHHRIHTGEKPYKCKECGKAFKQHSKLTRHLRIHTGEKPYKCKACG
KAFKQHSHLTNHYRIHTREKPYTCEECGKSGKLPSTLIRIHKTICSGEKPYKSKECGKAF
KQCSTLTQHHIIHTIEKPYKCKECGKAFNKPSTLTQHHRIHTGEKPYKCKECGKAFIQQS
HLTLHHRIHTRGSLTNLKTVREF
Download sequence
Identical sequences XP_021538071.1.83697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]