SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_021546464.1.83697 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_021546464.1.83697
Domain Number 1 Region: 231-486
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.62e-63
Family Eukaryotic proteases 0.000000171
Further Details:      
 
Domain Number 2 Region: 50-167
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.81e-23
Family Spermadhesin, CUB domain 0.00025
Further Details:      
 
Domain Number 3 Region: 195-239
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000889
Family Complement control module/SCR domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_021546464.1.83697
Sequence length 490
Comment complement C1r subcomponent-like protein [Neomonachus schauinslandi]; AA=GCF_002201575.1; RF=representative genome; TAX=29088; STAX=29088; NAME=Neomonachus schauinslandi; AL=Scaffold; RT=Major
Sequence
MSSSRCLVSEWGNNHWRSPHSTSCPGKMWWLLLWGVLQACPTQGSVLLAQQLPQQLTSPG
YPEPYLKGQENPTDIEAPEGFAVRLVFQDFDLEPSQDCEQDSVTITASGMDPSRFCGQQG
SPLGSPPDQREFVSPGNRLRLTFRAPASSQDRTTGLHKGFLALYQAVGVNRSQPVSQTRE
ASEARTRGDSPSKTQKRCQEPYYQAAPAGTLTCTPQGPWKETQDREELPHCIPVCGRPVT
PIAQNQEALGSSRAKLGNFPWQAFTNIYGRGGGALLGDRWILTAAHTIYPKDGIFLGKNR
SVEVFLGHTSVDEMLRLGSHPVRRVVVHPDYRQHESHNFDGDIALLELQRSVRLGPSLLP
VCLPERQALYRSGLWGYVSGFGVDRGWLTTQLKYSGLPVAPRAACQAWLQEKQRSEVFSA
NMFCAGDKMRQQNVCQGDSGGVYVVWDERAHHWVATGIVSWGVGCGKGYGFYTKVLNYLD
WIKGVMEGKV
Download sequence
Identical sequences XP_021546464.1.83697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]