SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_021547536.1.83697 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_021547536.1.83697
Domain Number 1 Region: 604-660
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.66e-24
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 2 Region: 435-492
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.8e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 3 Region: 491-548
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.05e-24
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 4 Region: 379-436
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.53e-24
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 5 Region: 547-604
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.74e-23
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 6 Region: 15-74
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.18e-22
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 7 Region: 323-380
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.09e-22
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 8 Region: 649-701
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.51e-17
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 9 Region: 271-324
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000823
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 10 Region: 211-265
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000269
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 11 Region: 110-159
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000263
Family Classic zinc finger, C2H2 0.035
Further Details:      
 
Domain Number 12 Region: 169-219
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000213
Family Classic zinc finger, C2H2 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_021547536.1.83697
Sequence length 702
Comment zinc finger protein 132 [Neomonachus schauinslandi]; AA=GCF_002201575.1; RF=representative genome; TAX=29088; STAX=29088; NAME=Neomonachus schauinslandi; AL=Scaffold; RT=Major
Sequence
MYKPICWPPGLAVSSSQSPVTFEDVAVYFSKEEWGLLDETQRRLYHHVMLENFELMTSLG
CWHGVEDEGAHSKQNTSVEGMSQVRIPSANPSTQKADTCDMCGPFLKDILHLNEHQRIYP
EETLYTCGTCGREFWFSTNLHQHQKELSGEKPFRWDKDEDSFVENLTIHLSEKLFTCGEG
GKDALDSDDLFQHPAIDSSRKPQRSTECRETFSHSSNLQQLTKVHTTQKLFKCSNCGKAF
QKTSTLLNHLRTHSKETTFRCPTVGNSLEEKSTLVNHQKSHDRETCHVCKACGKTFTHAS
KLRKHQKFHTGVKYYECSDCWKTFNHKLTLVHNQRIHTGERPYKCSECGKAFNNRSHLTR
HEKVHTGERPFECSKCGRAFSQSSNFLRHQKVHTQVRPYECNQCGKAFSRSSALIQHWRV
HTGERPYECSECGRAFNNNSNLAQHQKVHTGERPFECSECGRDFSQSSHLLRHQKVHTGE
RPFECTECGKAFSNSSTLIQHQKVHTGQRPYECSECRKAFSCSSSLIQHWRIHTGERPYE
CSECGKAFAHSSSLIEHWRVHTRERPYECSECGKFFSQNSILIKHQKVHTGERPYECTEC
GKFFSRKSSLIYHWRVHTGERPYECSECGRAFSNNSHLVRHQRVHTQERPYECSQCGKAF
SERSTLVRHQIVHTRERTYECDHCGKIFSHLCNLAQHKRIHT
Download sequence
Identical sequences XP_021547536.1.83697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]