SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_021550911.1.83697 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_021550911.1.83697
Domain Number 1 Region: 53-549
Classification Level Classification E-value
Superfamily Sema domain 2.22e-100
Family Sema domain 0.0015
Further Details:      
 
Domain Number 2 Region: 1412-1537,1703-1859
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.04e-33
Family p120GAP domain-like 0.028
Further Details:      
 
Domain Number 3 Region: 889-981
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000397
Family Other IPT/TIG domains 0.014
Further Details:      
 
Domain Number 4 Region: 980-1070
Classification Level Classification E-value
Superfamily E set domains 0.000000000000175
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.056
Further Details:      
 
Domain Number 5 Region: 1067-1148
Classification Level Classification E-value
Superfamily E set domains 0.00000000000397
Family E-set domains of sugar-utilizing enzymes 0.061
Further Details:      
 
Domain Number 6 Region: 552-603
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000929
Family Plexin repeat 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_021550911.1.83697
Sequence length 1927
Comment plexin-D1 [Neomonachus schauinslandi]; AA=GCF_002201575.1; RF=representative genome; TAX=29088; STAX=29088; NAME=Neomonachus schauinslandi; AL=Scaffold; RT=Major
Sequence
MARRAAGGAPLSARAAAASPLPRRPPFRAPSPCPLLPLLLLLGAARVGALEIQRRFPSPT
PTNNFALDGAAGTVYLAAVNRLYQLSGANLSLEAEAAVGPVADSPLCHAPQLPQASCEHP
RRLTDNYNKILQLDPGQGLVVVCGSIYQGFCQLRRRGNISAVAVRFPPAAPPAEPVTVFP
SMLNVAANHPNASTVGLVLPPAAGTGGSRLLVGATYTGYGSAFFPRNRSLEDHRFENTPE
IAIRSLDARGDLAKLFTFDLNPSDDNILKIKQGAKEQHKLGFVRAFLHPPDPPPGAPSYA
YLALNSEARAGDKESQARSLLARICLPRGAGGDAKKLTESYIQLGLQCAGGAGRGDLYSR
LVSVFPARELLFAVFERPQGSPASRATPAALCAFRFADVQAAIRAARNACFVEPAPDVVA
VLDSVVQGTGPACERKRNIQLQPEQLDCGAAHLQHPLSILQPLKATPVFRAPGLSSVAVA
MVSNYTVVFLGTVSGRLLKINLNESMQVVSRRVVTVAYGEAVHHVMQFDPADPGYLYLMT
SHQMARVKVAACAVHATCGDCVGAADAYCGWCALETRCTLQQDCANSDQRHFWTSASEGP
GRCPAMTVLPAEIDVHQEYPGMILQISGSLPSLSGLEMTCDYGNNIRTVARVPGPAFGHQ
IAYCNLLPRDRFPPFPPHQDHVIVAMSVRVNGRNIVRANFTIYNCSRIGQVYTHTACTSC
LSAQWPCFWCTQQHACVSNQSRCEASPNPASPQDCPQILPSPLAPMPTGSSQSIPVHLAN
AAFQGAALECSFGPEEIFEAIWVNESTVHCNQVVLHTTQKSQVFPLSLQLKGQPARFLDS
PDPMTVEVYNCAMGSPDCSQCLGREDLGHLCVWSDGCRLRGPLQPLPGTCPAPEIRAIEP
LSGPLDGGTLLTIRGRNLGRRLSDVAHGVWIGSVACEPLADRYTVSEQIVCATGPAPGAF
SDVVTVNASKEGKSRERFSYVLPLVQFLEPDKGPKAGGTRITIHGSDLHVGSELQVLVND
TEPCTELVRTDTSIACTVPEGALPAPVSVCVRFERRGCVRGNLTFQYMQNPVITAISPLR
SPVSGGRTITVAGERFHMVQNVSMAVHHIGREPTLCKVLNSTLITCPSPGALSNASAPVD
FFINGRAYADEVAVAEELLDPEEARRGGRFRLDYLPDPQFSTAKREKWIKHHPGEPLTLV
IHKEQDSLGLQSHEYRIKIGQVACDIQIVSDRVIHCSVNESLGTAEGQLPITIQVGNFNQ
TIATLQLGGSETAIIVSIVICSVLLLLSVVALFVFCTKSRRAERYWQKTLLQMEEMESQI
REEIRKGFAELQTDMTDLTKELNRSQGIPFLEYKHFVTRTFFPKCSSLYEERYVLPSQTL
NAQGSSTAQETHPLLGEWKIPESCRPNMEEGISLFSSLLNNKHFLIVFVHALEQQKDFAV
RDRCSLASLLTIALHGKLEYYTGIMKELLVDLIDASAAKNPKLMLRRTESVVEKMLTNWM
SICMYSCLRETVGEPFFLLLCAIKQQINKGSIDAITGKARYTLNEEWLLRENIEAKPRNL
NVSFQGCGMDSLSVRAMDTDTLTQVKEKILEAFCKNVPYSQWPRAEDVDLEWFASSTQSY
ILRDLDDTSVVEDGRKKLNTLAHYKIPEGASLAMSLTDKKDNTLGRVKDLDTEKYFHLVL
PTDELAEPKKSHRQSHRKKVLPEIYLTRLLSTKGTLQKFLDDLFKAILSIREDKPPLAVK
YFFDFLEEQAEKRGISDPDTLHIWKTNSLPLRFWVNILKNPQFVFDIDKTDHIDACLSVI
AQAFIDACSISDLQLGKDSPTNKLLYAKEIPEYRKIVQRYYKQIHDLTPLSEQEMNAHLA
EESRKYQNEFNTNVAMAEIYKYAKRYRTQIMTALEANPTARRTQLQHKFEQVVALMEDNI
YECYSEA
Download sequence
Identical sequences XP_021550911.1.83697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]