SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_021556664.1.83697 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_021556664.1.83697
Domain Number 1 Region: 49-162
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-28
Family Spermadhesin, CUB domain 0.00052
Further Details:      
 
Domain Number 2 Region: 257-371
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000034
Family Spermadhesin, CUB domain 0.0036
Further Details:      
 
Domain Number 3 Region: 460-497
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000497
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 4 Region: 170-207
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000127
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 216-255
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000012
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 421-458
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000236
Family LDL receptor-like module 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_021556664.1.83697
Sequence length 773
Comment low-density lipoprotein receptor-related protein 3 [Neomonachus schauinslandi]; AA=GCF_002201575.1; RF=representative genome; TAX=29088; STAX=29088; NAME=Neomonachus schauinslandi; AL=Scaffold; RT=Major
Sequence
MRTADGLNDDGEQILAGAPGARAQLAVVCLVNIVLTGRLSSAVPALAACSGRLEQHTERR
GVIYSPAWPLNYPPGTNCSWYIQGDRGDMITISFRNFDVEESHQCSLDWLMLGPAAPPRQ
EAFRLCGSAIPPAFISARDHVWIFFHSDASSSGQAQGFRLSYIRGKLGQVSCQADEFRCD
NGKCLPGPWQCNTVDECGDGSDEGNCSAPASEPPGSLCPGGTFPCSGARSTRCLPAERRC
DGTQDCGDGSDEAGCPDLACGRRLGSFYGSFASPDLFGAARGPSDLHCTWLVDTQDPRRV
LLQLELRLGYDDYVQVYEGLGERGDRLLQTLSYRSNHRPVSLEAAQGRLTVAYHARARSA
GHGFNATYQVKGYCLPWEQPCGSGGEGAAGAAGEQGCFSEPQRCDGWWHCASGRDEQGCP
ACPPDQYPCEGGSGLCYTPADRCNNQKSCPDGADEKNCFSCQPGTFHCGTNLCIFETWRC
DGQEDCQDGSDEHGCLAAVPRKVITAALIGSLVCGLLLVIALGCAFKLYSLRTQEYRAFE
TQMTRLEAEFVRREAPPSYGQLIAQGLIPPVEDFPVYSASQASVLQNLRTAMRRQMRRHA
SRRGPSRRRLGRLWNRLFHRPRAPRGQIPLLTAARTSQTVLGDGLLQPASGTTPEPPAPL
TDTGSPAAAGDGPPRGHAPEVGPAVPPPSGLRDLEGRLVDKDRKAGRDPRVDSPAPVDMP
RESCSTQDPHPPAPTASSTLGPHPAEPLGVCRSPPPPCSPTLEASDDEALLVC
Download sequence
Identical sequences XP_021556664.1.83697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]