SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_021581510.1.77405 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_021581510.1.77405
Domain Number 1 Region: 370-474
Classification Level Classification E-value
Superfamily SH2 domain 6.33e-26
Family SH2 domain 0.00000133
Further Details:      
 
Domain Number 2 Region: 482-523
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000000981
Family SOCS box-like 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_021581510.1.77405
Sequence length 536
Comment suppressor of cytokine signaling 5 [Ictidomys tridecemlineatus]; AA=GCF_000236235.1; RF=representative genome; TAX=43179; STAX=43179; NAME=Ictidomys tridecemlineatus; AL=Scaffold; RT=Major
Sequence
MDKVGKMWNNFKYRCQNLFSHEGGSRGESVDMNSNRCLSVKEKNISLGDSVPQQQSSPLR
ENIALQLGLSPSKNSSRRNQNCATEIPQIVEISIEKDNDSCVTPGARIARRDSYSRHAPW
GGKKKHSCSTKTQSSLDTDKKFGRTRSGLQRRERRYGVSSAHDTDSVPSRTLGSRSLRQR
LQDTVGLCFPMRTYSKQSKPLFSNKRKIHLSELMLEKCPFPAGSDLAQKWHLIKQHTAPV
SPHSTFFDTFDPSLVSTEDEEDRLRERRRLSIEEGVDPPPNAQIHTFEATAQVNPLYKLG
PKLAPGMTEISGDSSAIPQTNCDSEEDTTTLCLQSRRQKQRQVSGDSHAHVSRQGAWKVH
TQIDYIHCLVPDLLQITGNPCYWGVMDRYEAEALLEGKPEGTFLLRDSAQEDYLFSVSFR
RYNRSLHARIEQWNHNFSFDAHDPCVFHSSTVTGLLEHYKDPSSCMFFEPLLTISLNRTF
PFSLQYICRAVICRCTTYDGIDGLPLPSMLQDFLKEYHYKQKVRVRWLEREPVKAK
Download sequence
Identical sequences I3NAQ9
ENSSTOP00000021456 ENSSTOP00000021456 XP_005324554.1.77405 XP_005324555.1.77405 XP_021581510.1.77405 XP_021581511.1.77405 XP_021581512.1.77405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]