SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_021582133.1.77405 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_021582133.1.77405
Domain Number 1 Region: 24-74
Classification Level Classification E-value
Superfamily Elafin-like 0.000000000017
Family Elafin-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_021582133.1.77405
Sequence length 78
Comment WAP four-disulfide core domain protein 12 [Ictidomys tridecemlineatus]; AA=GCF_000236235.1; RF=representative genome; TAX=43179; STAX=43179; NAME=Ictidomys tridecemlineatus; AL=Scaffold; RT=Major
Sequence
MKLSSLSLLSVAALLWLRVAQANMKEVQQKSGYCPEFFLSCSFTLLPRCRRDGGCNGPKK
CCFYQCQQQCMQPWPTLD
Download sequence
Identical sequences I3NAX1
XP_021582132.1.77405 XP_021582133.1.77405 ENSSTOP00000021518 ENSSTOP00000021518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]