SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_021583339.1.77405 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_021583339.1.77405
Domain Number 1 Region: 71-172
Classification Level Classification E-value
Superfamily SH2 domain 2.83e-23
Family SH2 domain 0.00027
Further Details:      
 
Domain Number 2 Region: 165-210
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000196
Family SOCS box-like 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_021583339.1.77405
Sequence length 211
Comment suppressor of cytokine signaling 1 [Ictidomys tridecemlineatus]; AA=GCF_000236235.1; RF=representative genome; TAX=43179; STAX=43179; NAME=Ictidomys tridecemlineatus; AL=Scaffold; RT=Major
Sequence
MVAHNQVAADNAISAAAESRRRPEPSSSSSSSSPAAPARPRPCPAPAPAPGDTHFRTFRS
HADYRRITRASALLDACGFYWGPLSVHGAHERLRAEPVGTFLVRDSRQRNCFFALSVKMA
SGPTSIRVHFQAGRFHLDGSRESFDCLFELLEHYVAAPRRMLGAPLRQRRVRPLQELCRQ
RIVATVGRENLARIPLNPVLRDYLSSFPFQI
Download sequence
Identical sequences I3N8T4
XP_021583339.1.77405 ENSSTOP00000020780 ENSSTOP00000020780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]