SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_021954941.1.6718 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_021954941.1.6718
Domain Number 1 Region: 79-534
Classification Level Classification E-value
Superfamily Sema domain 1.44e-115
Family Sema domain 0.000045
Further Details:      
 
Domain Number 2 Region: 1434-1560,1821-1977
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.92e-43
Family p120GAP domain-like 0.026
Further Details:      
 
Domain Number 3 Region: 896-986
Classification Level Classification E-value
Superfamily E set domains 0.000000000000382
Family Other IPT/TIG domains 0.019
Further Details:      
 
Domain Number 4 Region: 988-1078
Classification Level Classification E-value
Superfamily E set domains 0.00000000000109
Family Other IPT/TIG domains 0.0085
Further Details:      
 
Domain Number 5 Region: 1076-1149
Classification Level Classification E-value
Superfamily E set domains 0.00000000000789
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.08
Further Details:      
 
Domain Number 6 Region: 536-587
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000392
Family Plexin repeat 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_021954941.1.6718
Sequence length 2041
Comment LOW QUALITY PROTEIN: plexin-B-like [Folsomia candida]; AA=GCF_002217175.1; RF=representative genome; TAX=158441; STAX=158441; NAME=Folsomia candida; strain=VU population; AL=Scaffold; RT=Major
Sequence
MTKMDGVSHFKFYLTLRSHSFPVLLIILGLLIRPGSSGPPSSSPLAQIDMHGPSSSSSSG
GGGGLGLESAVLSQFVTLNETYALKHLALDSLSGRVYVGAINRLYELDPNLRLEATVPTG
PKLDNPNCHASGCGTDAETTEVLLTNNVNKVLLVDGGSRTLISCGSVSQGACHKYNLTNI
TLPPEFATHAVAANDEASSTFAFVGPAKYNAWATQNVLYVGTTFTNLGDYRHDVPAISSR
NLYNFDYAEYSFAKQSMLRIDVKYRDHFLVKYVYGFNASDFAYFMIVQKQSYLHGFEEQG
YVSRLARTCITDANYDSYTEVTLQCNGNGNVNFNLVQDAKIIPARDDLARSLGIKKGDLV
LVAVFAQSKGITNEPQPDSAVCIYSMHDIEAKFTENIHMCFNGSVENRNMDYISGPILDG
KCYEPGAAGNIPDFCDVGLKISGAIPIVRTAAIRFQDVLLSSIALASTEQHTVAFAGTSQ
GVIKKLLLSSVHRVDHYGDIEMDPGYAILPDTTLDPSGRYIYSISSNKVLKARVEQCEMH
QNCSTCLSSHDPYCGWCSLEKRCTVRAACKKALSSSPRWLAFGSGQECISFERAQPDRIP
INQVGLVMLVIRPNLPAGAKYKCVFGSAPPIDAELKPHGLECKTPSVNYRPLIPEDQDHI
QVDLAVRSSETNKDFVSRAFYYYNCSRHTRCRSCVKASWGCNWCLYENRCVHDTTVCNSS
SIISGEKVALLHMMHQNPAQMAKHGSGFCPRFRTPSEPLLIPNNVAKRLKLEVENLPRQA
NHADVHCIIVIEGSTVKVPAKIDASRFVLCDETTLSYKSQQGEYEGTVTVMWKQNHHLDT
MNFTLYKCEILGSHRSHPDCSLCVTPSNSKYRCTWCGDTCTFRDQCLKSAVQMSKCPKPR
IDVIKPLSGPIEGGTLLTIEGSDLGLKQEDVRGKIHIGNVPCELVDYQVSVRIVCRTGKV
DREMDSPIKVGNSVGYTNSTVYFSYKDIRIIGVTPNKGPRSGGTQLTIMGSHLNIGSSVR
VNLKDYPCHVNSTHSSSSRITCTTSQAIMNETVGRLQVMVDNAVRGLQDDNLFQYMPDPT
IVEIKPFKSFVSGGRMITVHGTHLDAIQSPEMVVYTDQHSKTMSNRTTCTVINSSQMECP
SPPINSDWEQQLLSGVSVNYGAYTGSRRNTRATVSGRRADRGAEIAKRVGFVMDNVESVL
NLQNYLPVDKCQLVYVEDPVVYPFPNHLKPYKGDTLVIEGEHLNEACDETDVTVSIGSQK
CNVTSLAQMQLVCTPPEFQPPGNDDRGLPMVTVKVGQFLRFQVGYLQYELMKTNNFPVEA
YFVAAIAAFILLSLFAFIVFVYRRKSTQAEREYKRIQIQMDTLESNVRSECKQAFAELQT
DMRDLTVDLGAAIPTLDHKNYVMRCFFPGVTEHPILRDPKMRINGSATNYDAAMSQFELL
LNNKYFLLTFVETLEGQRSFKLRDKVNVASLLMIILMGKMEYATDILQSLLHKLINKSVG
SKHPQLMLRRTETVVEKMLSNWMALCMYNYLKDHVGPSLFLLFKAIKYQIEKGPVDSLTH
DARYSLSEERLLREPIDFSVVTIHLVQEDPYYEKIPYQSYQTFQVVQEELDEKIQCKVLD
CDTITQVKSKILDALYKNTHFSLRPSVHDLDLEWRHGRGGHLTLQDEDLTTRASSGWKKL
NTLAHYGIKDSAVMSLVARPNDSYSNTMSLCKKPCNYHTCKSRSLSLSCYNIRNGYFXVG
TFXYRTFHLGTDSGAYLNSSMSPMVGNGVNMGMGMNMTLGNSNHSSRDCPTYHLVKPVED
HVSGKDQRINDRDRAHKAIPEIFLTRLLSTKGTIQKFVDDFFDSIFSINDSIPPAIKWLF
DLLDEAARRHNIVDPEVVHAWKSNSYPLRFWINFIKNPDFIFDVEKTPTVEASLGVIMQT
MMDSCATSEQRLGKDSPSSKLLFAKDIPHYRNLVSKFYADIKNLPQISDQEMNSAMQQLS
MSHIAHFDHAAALKELYIYVTQYNNQILEALEMEPYCKKMHLAHRLENCACTLEGEETSL
C
Download sequence
Identical sequences XP_021954941.1.6718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]