SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_022044825.1.10920 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_022044825.1.10920
Domain Number 1 Region: 29-513
Classification Level Classification E-value
Superfamily Sema domain 1.7e-99
Family Sema domain 0.00087
Further Details:      
 
Domain Number 2 Region: 1385-1510,1676-1860
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 8.24e-34
Family p120GAP domain-like 0.025
Further Details:      
 
Domain Number 3 Region: 858-949
Classification Level Classification E-value
Superfamily E set domains 5.95e-17
Family Other IPT/TIG domains 0.018
Further Details:      
 
Domain Number 4 Region: 948-1022
Classification Level Classification E-value
Superfamily E set domains 0.000000000021
Family Other IPT/TIG domains 0.033
Further Details:      
 
Domain Number 5 Region: 1041-1118
Classification Level Classification E-value
Superfamily E set domains 0.000000000113
Family E-set domains of sugar-utilizing enzymes 0.036
Further Details:      
 
Domain Number 6 Region: 515-568
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000227
Family Plexin repeat 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_022044825.1.10920
Sequence length 1900
Comment plexin-D1 [Acanthochromis polyacanthus]; AA=GCF_002109545.1; RF=representative genome; TAX=80966; STAX=80966; NAME=Acanthochromis polyacanthus; ecotype=Palm Islands; AL=Scaffold; RT=Major
Sequence
MPPSIEIAVLLLGVLALETRRSASALHIQQAFASPNHTNNFVVDPVSRKVYLATVNSVYQ
LNGTLNVEVEKRTGPVEDNLLCHAPQLPQAPCEHPKSLTDNYNKLLKLDREQGVVVVCGS
VYQGFCELRKMDNISEIAVEFPPQGEKTVFPSMLNIAANHPNASTVGLIFKSHGGNTRLL
VGATYTGAGTQFFPKNHSKEDLRFENTPEIAIRSLNIKDLSRLFTYDINPSEDNVFKIKQ
EVKTKNKLNFVHAFIQKTYSYIAFNNDAKMGHKESQPNSILSRICLDTENLRKSTGPESR
KLTESYIQMPLQCGFNGNIYNRLLSVYPAEIQGEDGLSSEPYLFGVFSKADKKSALCAFK
FGDIEEEIRQGRRNCSNSPSSDVQVLDSVIQGSGAACIQKGNLVLQPEQLDCGAAHLQHP
LALRRSLRAAPLFEYPGLSSVSVDNVHGHTVVFLGTSNGRLRKLTLLANMTVANQWALKL
PAGEAVHHIMTFDPNDSNFLYVMTSHHMLRVKVAQCDQWRSCSDCLGAGDAHCGWCTLEN
RCTIQKECARGLLARSWISMAEGPQQCPSMTLTPPEISIAADIKDVGILINGSVPDLIGS
RVECEYGLGVSTAATVHLDHGPAQIQTCPLLPREKYQPILPGTDHLTVSVAIKVNGTSVV
SGSFIIYDCERTGAIHPKTSCVSCLSTRWKCYWDQENHLCVSTKDESKHNLLENAASCPS
LLASEVPPSPSGAAQDFILSLSNIQETEKLECDFGTEQRYEATWLNSSTVKCSGVTLFTN
QRSQIYHLNLRRRVSFGGQTEDVFVDSPQPMKVEVYNCGVGSSDCSQCWGREEQRHICGW
CENSCRPRDDCQPIRDQCPAPEIHKISPLRGPVEGGTLLTVQGRNLGRRAGAVKVYIGDV
PCTLQPERYTVSTELVCLTGKSAQDRTDIVHVEVDQSGTGTSKESFSYLMPKLLSMEPRK
GSRAGGTRVTIRGEHLDIGSQVMVRVNNTWECNITEKTDETIECTMPEAGQAHTDSVTVC
VEFENLPCQVVELSATYTYEKNPTIGYIHPKKSFLSGGRTITVTGLGFDLVQSVTMQVLG
IGQTHCEVLSPSTIICPSPASSQSQQTSVQFFLNGVPYKGDSPSSSEDEPEEEEEEEPHK
GHFNLEYVEDPQFFTANKEKLIKHHSGEPLTLIINKVPSDLELVPEEYSVMIGTYPCNIS
FHNDQLFHCTINGLPSSSERELPVTVQVGNFHHTIAKVQLGGSELAIVVSIVVCCVLLLL
CTVALVVYCTKSRRAERYWQKTLLQMEEMESQIREEIRKGFAELQTDMTDLTKELNRSQG
IPFLEYKQFVTRTFFPKMCSDYEKSLVQPAYENDGLGPRALPETHPLLQDWQATNTTRPN
VEEGITLFSTLLNNKHFLITFVHALEQQKDFAVRDRCSLASLLTIALHGKLEYYTSIMKD
LLVDLIDASAAKNPKLMLRRTESVVEKMLTNWMSICMYSYLKETVGEPFFLLLCAIKQQI
NKGSIDAITGKARYTLNEEWLLRENIEAKPQNINVSFQGCGMDSLSVRVMNTDTICQVKE
KIIEAFYKNLPFSQWPRAEDVDLEWFDSGSNSKLLQDLDNSSVMEDGRKKLNTVFHYQIP
EGASLAMSMKDKKENTLGRVKDLDTEKYVHLVLPHDELMETKRSHRQSHRKKVLPEIYLT
RLLSTKGTLQKFLDDLFQAILSIPPDRPPLAVKYFFDFLEEQADKRGITDPDTLHIWKTN
SLPLRFWVNILKNPQFVFDIDKTDHMDACLSVIAQAFIDACSISDLQLGKDSPTNKLLYA
KEIPEYKKRVQCYYQQIQDMAPLSEQEMNAHLAEESRKYRNEFNTNLALTEIYKYAKRYR
NQVVNALESNPTARRTQLHHKFEQVIALVEDNIYECCSEA
Download sequence
Identical sequences XP_022044825.1.10920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]