SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_022070316.1.10920 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_022070316.1.10920
Domain Number 1 Region: 218-395
Classification Level Classification E-value
Superfamily MIR domain 1.83e-47
Family MIR domain 0.0014
Further Details:      
 
Domain Number 2 Region: 1079-1170
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000338
Family SPRY domain 0.069
Further Details:      
 
Domain Number 3 Region: 629-801
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000783
Family SPRY domain 0.058
Further Details:      
 
Domain Number 4 Region: 3950-4009
Classification Level Classification E-value
Superfamily EF-hand 0.000000357
Family Calmodulin-like 0.048
Further Details:      
 
Domain Number 5 Region: 2075-2140
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000379
Family IP3 receptor type 1 binding core, domain 2 0.025
Further Details:      
 
Domain Number 6 Region: 102-183
Classification Level Classification E-value
Superfamily MIR domain 0.0000458
Family MIR domain 0.027
Further Details:      
 
Domain Number 7 Region: 436-547
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000824
Family IP3 receptor type 1 binding core, domain 2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_022070316.1.10920
Sequence length 4886
Comment ryanodine receptor 3-like [Acanthochromis polyacanthus]; AA=GCF_002109545.1; RF=representative genome; TAX=80966; STAX=80966; NAME=Acanthochromis polyacanthus; ecotype=Palm Islands; AL=Scaffold; RT=Major
Sequence
MAEGGEGEDEIQFLRTDDEVVLQCVACIQKENRKFCLAAEGLGNRLCYLEPTSEAKYVPP
DLCICTFVLEQSLSVRALQEMLAKSGQNSEGAAQSGGHKTLLYGHAILLRHSFSSMYLAC
LKTSRSQTDKLSFDVGLQEDSTGEACWWTIHPASKQRSEGEKVRIGDDLILVSVSSERYL
HLSISNGNIQVDASFMQTLWNVHPICSGSNIEEGYLLGGHVMRLFHGHDEVVTIPGSDQS
EEQQRIVNYETGKAGAKARSLWRLEPLRISWSGSHIRWGQPFRLRHLTTGHYLALTEDRG
LVLQDRERSDTVATAFCFRASKEKLEQSPKRDIEGMGVAEIKYGDSLCFIMHVATGLWLS
YQAPDVKSARLGPLKRRACLHSEGHMDDGLTLQRCQHEESRAARIIRNTTLLFNRFIGDL
DCLGVKNRALVALPVEEVLQTLNDLITYFQLPDVELEHEERQIKLRSLKNRQNLFKQEGM
LTLVSNCIDRLNVYNSAAHFGECAGSEAGAAWKDILNLLYELLAALIRGNRNNCTQFSNN
LDWLVSKLERLESSSGILEVLHCILIESPEALNIIQRGHIKSIISLLYKHGRNHKILDVL
CSLCVCNGVAVRTNQNLICDHLLPKRDLLLQTQLVNDVQSMRPNIFLGVSDGSAQYRKWY
YELMIDQVDHFVTSEPSHLRVGWANTKGYAPYPGGGEGWGGNGVGDDLYSYGFDGLHLWS
GRIPRAVASMNQHILTSEDVVSCCLDLGAPSISFRINGQPVQGMFENFNTDGLFFPVVSF
SAGVKVRFLLGGRHGDFKFLPPSSYAPCYEALLPKEKMKVEPVKEYKRDADGVRDLLGTT
QFMSQASFIPAPVETSQIVMPPHLEKVRDKLAENIHELWGMNKIELGWSYGKRIRDDNKR
QHPCLVDFSKLPETEKNYNLQMSTETLKTLLALGCRVVQVNPNAEDSLKKIKLPKNYMMS
NGYKPSPLDLSDIKLTPGQELLVDKLAENAHNVWAKDRIKQGWTYGIQQDLKSKRNPRLV
PYVLLDERTKKSNRDSLREAIRTLIGYGYNIEPSDQEGGQVVERLSIDKIRFFRVERTYA
VKMGKWYFEFEAVTGGDMRVGWARPGCKPDMELGTDDLAFVFDGYRGHCLNMGSRLFGRC
WHAGDVVGCMINMEDKSMIFTLNGEILITTKGSELCFTDFETEDGFIPVCSLGLSQVGRM
NLGKDASTFKYYTMCGLQEGFEPFAVNMNREVTMWFSKRLPTFVNVPKDHNHIAVTRIDG
TIDSPPCLKVTHKTFGTQNSNADMVFCRLSMPVEFHSFFKSSPVVDMNGVHEEDILKVKH
RYPLRSVRHSDESRRVDYSSITMYYHSVRVFAGQDPACVWVGWVTPDYHYYSNNFNLSKN
RTVTVTLGDERGRVHESVKRSNCYMVWGGDVTSAAHTSSRSNVDLEIGCLIDLATGLVTF
SVNGKDISTSYQVEPNTKLFPAVFVRPTSPNLFQFELAKIKNAMPLSSAIFKSEHKNPVP
QCPPRLDIQTINAVLWSRMPNTFLKVETARVNERHGWVVQCVEPLQMLAVHIPEENRCVD
IMELSEQQDMRMFHYHTLKLYCALCALGNTRVAHALCSHLDQSQLLYTIDNQYLSGMLRE
GFYNVLISIHLETAKEARLMMKDEFIIPVTAETRSIRLFSDASKKHLPPGVGLSTSLKPR
LNFVPPCFINTRREHLYSPQIPLDALKEKAISMLTEAVQGGGHHIRDPVGGGVEYQFVPI
LKLISTLLTMGVLGSEDVHKILLLIDPNVFRETREEGATGAIDKEGLTGTEEKAVEAGEE
EAAKEAKQPMKGLLEKRLPEPVKRQMCELLHYFCDCELKHRIEAIVSFSDSFVSKLQYNQ
KFRYNELMLALNMSAAVTAKKTKEFRSPPQEQINMLLTFSMGEDCPCPTDIQEELYDFHN
QLQLHCGIPMEEDEDEQDSSIKGRLLMLVNKIKGQSHKAEEPAEKQQAAPSNLKELISQT
MVSWAQECHIQDAELVRKMFSLLRRQYDSIGELLRAMRKTYTISAASVQDTINLLASLGQ
IRSLLSVRMGKEEEKLMIDGLGDIMNNKVFYQHPNLMRILGMHETVMEVMVNVLGGDKSQ
EIAFPKMVASCCRFLCYFCRISRQNQKAMFDHLSYLLENSSVGLASPAMRGSTPLDVAAS
SVMDNNGLALALEEPDLDKVVTYLAGCGLQSCPMLLAKGYPDIGWNPIEGERYLSFLRFA
VFVNGESVEENSSVVVKLLIRRPECFGPALRGEGGNGLLAAMKEAIKISETPALDLPGSV
QGVSSDVSADGDDEEEVVHMGNAIMSFYSALIDLLGRCAPEMHLINKGKGEALRIRAILR
SLVPTEDLVGIISIPLKMPIINKDGSVTEPDMSASFCPDHKAPMVLFLDRVYGIEDQSFL
LHLLEVGFLPDLRAATTLDTDGLCTTETALAMNRYIGSAMLPLLTRCAPLFAGTEHYATL
IDSTLHTIYRLSKGRSLTKAQRDAIEECLLSVCKHLRPSMLQQLLRRLVFDVPLLTDYCK
MPLRLLTNHYEQNWKFYCLPSGWGSFGTASEDELLLTKKIFWGVFDSLSQRKYDPELFKM
AMPCLSAIAGALPPDYVDASINTTVEKPVSVDAQGNFDPKPINTANIALPEKLEHFANKY
AEHSHEKWSAEKVLLGWKYGDCVDEKAKTHPQLRTYKALTEKEKEIYRWPIRESLKSILA
MGWSIDRTKDGETMSQQRESEKMRKISQASQANGFNPSPIDTSNVVLSRELQGIVEAVAE
NYHNIWAKKKKSDLGSRGGGTHPLLVPYDTLTAKEKARDREKAQDLFRFLQINGYSITRG
LKDLEQDSSSMEKRFAYKFLKKLLKYVDSAQEFISHLEAMAASGKTDRSPHEQEIKFFAK
VLLPLIDQYFKNHSLYFLSSPNKNLSSSGYASNKEKEMVTSLFCKLAALVRHRISLFGSD
STTMVSCLHILAHTLDTRTVMKSGSEMVRVGLRTFFENAAEDLEKTFENLKLGKFTHSRS
QMKGVSQNINYTTVALLPILTALFEHITQHHFGVDLLLDDVQVSCYRILTSLYALGTGKN
IYVERQLPALGQCLATLAGAMPVAFLEPLLNTYNPCSVFNTKSARERAILGIPDSVEEVC
PGMPRLDGLMKDINDMAESGARYTEMPHVIEVVLPMLCNYLSYWWERGPENQPASGGSIC
CTTVTSEHLSLILGNILKILNNNLGIDEASWMKRIAVYVQPIIGKARADLLKSHFLPTLE
KLKKKTVKVVAEEELLKADSKGDTQEAELLILDEFAVLCRDLYAFYPMLIRYVDNNRSRW
LKEPDSDSNELFRMVAEIFILWCKSHNFKREEQNFVVQNEINNLSFLTGDNKTKMSKSFK
EKSGGQDQERKHKKRRGEFYSIQTSLIVAALKKMLPIGLNMCTPGDQELISLAKIRYLLK
DTDDEVKDHIRQNLHLREKSEDPAVRWQLNLYKDIVMRTEGPPDPERVVDRIQRISAAVF
NLEQVEQPLRSKKCVWQKLLSKQRKRAVVACFRMAPLYNLPRHRSINLFLLAYQRIWIET
EEYSFEEKLVQDLAKTQPKVEEEEEEEERKQPDPLHQLILHFSHNALTECSSLEEDPLYI
AYADMMAKSCAEGEEEEEEEEKEKTFEEKEMEKQKMLYQQARLHDRGAAEMVLQMISASK
GRLGAIVTFTLKLGISILNGGNILVQQKMLDYLKEKRDVGFFKSLSGLMMSCSVLDLNAF
ERQNKAEGLGMVTEEGSINVSERGSKVLQNDEFTKDLFRFLQLLCEGHNNDFQNFLRTQT
GNTTTVNIIISTVDYLLRLQESISDFYWYYSGKDVIDEAGQRNFSKALAVAKQVFNSLTE
YIQGPCIGNQQSLAHSRLWDAVVGFLHVFANMQMKLSQDSSQIELLKELLDLQKDMIVMM
LSLLEGNVVNGTIGKQMVDTLVESSSNVEMILKFFDMFLKLKDLTTSDSFKEYDAESKGV
ISKKDFQKSMENQKQYSQSEIEFLLSCAEADENDMFSYEQFVERFHEPAKDIGFNVAVLL
TNLSEHMPHDARLSTFLDLAESVLSYFEPYLGRIEIMGGAKRIERVYFEISESSRTQWEK
PQVKESKRQFIFDVVNEGGESEKMELFVNFCEDTIFEMQLASQISEPDPVERPEEDEDDN
QSIVENPEEEEEESVMMESSSAFTIACISMRKSLCHFRQLLTLKSMRRQYRKFRKMSVRE
MVRGFFSFFWMIITGLFHFVYSLIWGFFHILWTTMFGGGLVEGAKNMKVTDILGNMPDPT
QFGIHGDVLETEKMEANEAAALAEMGQMAQGDAAEADLMAELLNIQPKKEGKHGTEPGLG
DVSEVVVGDAPSIASAVKQKKAQMAAKKRSTNGDFTSDAEKEDSEDGEKKDHDKAKDESP
PEPSVEEKKAPKKRLGPRREPPEAFMASFFAGLEVYQTKMLNYLARNFYNLRFLALFVAF
AINFILLFYKVTGDYSDDEDPWNGRGRAGEEEDEGALEYFVLQESTGYMAPTLRCLAILH
TIISFLCVVGYYYLKVPLVVFKREKEIARKLEFAGLYITEQPSDDDIKGQWDRLVINTPS
FPNNYWDKFVKRKVIKKYGDLYGAERIAELLGLDKSALDFNPTEETVAKEASLVSWLGSI
DTKYHVWKMGVVFTDNSFLYLVWYTTMSILGHYNNFFFAAHLLDIAMGFKTLRTILSSVT
HNGKQLVLTVGLLAVVVYLYTVVAFNFFRKFYNKSEDEDEPDMKCDDMMTCYLFHMYVGV
RAGGGIGDEIEDPAGDPYELYRILFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVK
EDMETKCFICGIGNDYFDTTPHGFETHTLQEHNLANYLFFLMYLINKDETEHTGQESYVW
KMYQERCWDFFPAGDCFRKQYEDQLG
Download sequence
Identical sequences XP_022070316.1.10920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]